Glyma13g08080 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g08080

Feature Type:	gene_model
Chromosome:	Gm13
Start:	8308437
stop:	8311757
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g08080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G44800	AT	Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein \| chr2:18467004-18468551 FORWARD LENGTH=357	SoyBase	E_val: 1.00E-21	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0071456	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to hypoxia	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016706	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors	SoyBase	N/A	ISS
PTHR10209	Panther	FE(II)/ ASCORBATE OXIDASE SUPERFAMILY	JGI		ISS
PTHR10209:SF55	Panther	OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI	JGI		ISS
UniRef100_G7JV63	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Flavonol synthase/flavanone 3-hydroxylase n=1 Tax=Medicago truncatula RepID=G7JV63_MEDTR	SoyBase	E_val: 6.00E-66	ISS
UniRef100_I1LX66	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LX66_SOYBN	SoyBase	E_val: 2.00E-123	ISS

Expression Patterns of Glyma13g08080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g08080

Paralog	Evidence	Comments
Glyma08g07460	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g08080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g042200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g08080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g08080

Limit To All Plant Sequences

>Glyma13g08080.1   sequence type=CDS   gene model=Glyma13g08080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCAACCGCTTCTGAGGTTAGCCAACAAGTACAATCCAATAACAGAACAAGTTTCACAAGTGTGAAAGCACTAACTAAATCACCAGAACTCACTTCCCTCCCACCCTCATACACAACCACCAATTCAGATGATGAAATAGTGGCAGACCCAGATGAAGATGATCCAATTCCCATCATTGACTATTCTCTCTTAGTTACTGGCACACTTGATCAACGTGCCAAGACCATCCATGACTTGCGCAAGGCTTGTGAGGAGTGGAGGTTCTTCATGCTCATCAACCACTTTGTGTCAAAGACCATCTTGGAGAAGATGGTTGATGAAATTTTTGCTTTCTTCAATCTTAGAGAGGAGGAGAAGCAAGAGTATGTTGGTAAGGATGTGATGGACCCTGTAAGGTATGGCACCAGCTCCAATGTTTCGATGGACAAAGTCTTGTTCTGGAGGGATTTTCTTAAAATCGTGGTGCACTCGGAATTTCACTCACTTGACAAACCACCTGGGTTCAGCTTTTATGTTCAATATCGAGCGTCTCGTTATATTACAGGACTCAATTGA

Predicted protein sequences of Glyma13g08080

Limit To All Plant Sequences

>Glyma13g08080.1   sequence type=predicted peptide   gene model=Glyma13g08080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTASEVSQQVQSNNRTSFTSVKALTKSPELTSLPPSYTTTNSDDEIVADPDEDDPIPIIDYSLLVTGTLDQRAKTIHDLRKACEEWRFFMLINHFVSKTILEKMVDEIFAFFNLREEEKQEYVGKDVMDPVRYGTSSNVSMDKVLFWRDFLKIVVHSEFHSLDKPPGFSFYVQYRASRYITGLN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain