SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g07850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g07850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g07850

Feature Type:gene_model
Chromosome:Gm13
Start:8072292
stop:8074029
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G02170AT Annotation by Michelle Graham. TAIR10: metacaspase 1 | chr1:411883-413426 FORWARD LENGTH=367 SoyBaseE_val: 6.00E-58ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0043068GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of programmed cell death SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0004197GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00656PFAM Caspase domain JGI ISS
UniRef100_G7JCS0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Metacaspase-1 n=1 Tax=Medicago truncatula RepID=G7JCS0_MEDTR SoyBaseE_val: 4.00E-104ISS
UniRef100_UPI000233AE0AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AE0A related cluster n=1 Tax=unknown RepID=UPI000233AE0A SoyBaseE_val: 1.00E-154ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g07850 not represented in the dataset

Glyma13g07850 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g07640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g044400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g07850.2   sequence type=CDS   gene model=Glyma13g07850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTCCGTTTGTCAAATGGTTGTTGGGTTTTCTGAGAGGAGGGAGTTTGACAAAATTCTATTCTACTCTAAACAGATTTTATTATTCTCCTCGATGTTTCTGTTTCTGCTTCAACTTGATCAAAGGAACCATTAATGATATTAGTAACATGAAGGAACTGCTCATCAAGAATTTTAAGTTTCCAAAGGAGTGCATACGTGTCCTCTCAGAACAAGAGCAGAATGCCAATTTAATACCAACGAAACACAACAAGTTGGAGTCCTTAAAGTGGCTGGTGAAGGACTGTCAGCCAGGAGATTCATTTGTCTTTTACTTCTCGGGACACGGTTTGCAACAGCCAGATTTCAAAGAAGACAAAATTGATGGGTTTGATGAGACTCTTTGTCCTGTTGATTTTTTGGGAGAAGGAATGATCATTGACAATGAAATAAATTCTATCATAGTGTGGCCACTGAAGGAAGGTGTCACACTTCATGCTATTGTTGACGCTTGTCATAGTGGAACAATTCTTGATCTTTTGTTTAAACATACAAGTGGTGGATTGGCAATTTGTCTTAGTGGTTGTGAAGATAGTCAGACAGCTGCTGATAGCTCATTCAATAGATACTTGCACCTCATGGTGGGGAATGAATATGGTGTACTGACTTATCATTTCACAAAAACAATCAGAGAATACTCTGGAATAACTTATGGGGGTCCCCTAGAAAAGATGCATGACGAAATTAAAAAGATTAACCGAAGCAGATGCAATAACCGCATATTGCAACATATCTTAATC

>Glyma13g07850.2   sequence type=predicted peptide   gene model=Glyma13g07850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVPFVKWLLGFLRGGSLTKFYSTLNRFYYSPRCFCFCFNLIKGTINDISNMKELLIKNFKFPKECIRVLSEQEQNANLIPTKHNKLESLKWLVKDCQPGDSFVFYFSGHGLQQPDFKEDKIDGFDETLCPVDFLGEGMIIDNEINSIIVWPLKEGVTLHAIVDACHSGTILDLLFKHTSGGLAICLSGCEDSQTAADSSFNRYLHLMVGNEYGVLTYHFTKTIREYSGITYGGPLEKMHDEIKKINRSRCNNRILQHILI







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo