SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g07610

Feature Type:gene_model
Chromosome:Gm13
Start:7807013
stop:7808518
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g07610
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G38410AT Annotation by Michelle Graham. TAIR10: Ribulose bisphosphate carboxylase (small chain) family protein | chr5:15377501-15378306 REVERSE LENGTH=181 SoyBaseE_val: 7.00E-105ISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0015977GO-bp Annotation by Michelle Graham. GO Biological Process: carbon fixation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0080158GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast ribulose bisphosphate carboxylase complex biogenesis SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009573GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ribulose bisphosphate carboxylase complex SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0016984GO-mf Annotation by Michelle Graham. GO Molecular Function: ribulose-bisphosphate carboxylase activity SoyBaseN/AISS
PF00101PFAM Ribulose bisphosphate carboxylase, small chain JGI ISS
PF12338PFAM Ribulose-1,5-bisphosphate carboxylase small subunit JGI ISS
UniRef100_C6T1Y2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribulose bisphosphate carboxylase small chain n=1 Tax=Glycine max RepID=C6T1Y2_SOYBN SoyBaseE_val: 3.00E-131ISS
UniRef100_C6T1Y2UniRef Annotation by Michelle Graham. Best UniRef hit: Ribulose bisphosphate carboxylase small chain n=1 Tax=Glycine max RepID=C6T1Y2_SOYBN SoyBaseE_val: 3.00E-131ISS

Expression Patterns of Glyma13g07610
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g07610
ParalogEvidenceComments
Glyma19g06340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g07610 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g046200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g07610
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g07610
>Glyma13g07610.1   sequence type=CDS   gene model=Glyma13g07610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCTCAATGATCTCCTCCCCAGCTGTTACCACCGTCAACCGTGCCGGTGCCGGCATGGTTGCTCCATTCACCGGCCTCAAATCCATGGCTGGCTTCCCCACGAGGAAGACCAACAATGACATTACCTCCATTGCTAGCAACGGTGGAAGAGTACAATGCATGCAGGTGTGGCCACCAATTGGCAAGAAGAAGTTCGAGACTCTTTCCTACTTGCCAGACCTCGATGATGCCCAATTGGCAAAGGAAGTCGAATACCTTCTAAGGAAAGGATGGATTCCTTGCTTGGAATTCGAGTTGGAGCACGGTTTCGTGTACCGTGAGCACAACAGGTCACCTGGATACTATGATGGACGCTACTGGACCATGTGGAAGCTGCCTATGTTTGGCTGCACTGATGCTTCTCAGGTGTTGAAGGAGCTTCAAGAGGCTAAGACTGCATACCCCAATGGCTTCATCCGTATCATTGGATTTGACAACGTTCGCCAAGTGCAGTGCATCAGCTTCATCGCCTACAAGCCCCCAGGCTTCTAA
Predicted protein sequences of Glyma13g07610
>Glyma13g07610.1   sequence type=predicted peptide   gene model=Glyma13g07610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSMISSPAVTTVNRAGAGMVAPFTGLKSMAGFPTRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPPGF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo