SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g07450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g07450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g07450

Feature Type:gene_model
Chromosome:Gm13
Start:7551777
stop:7553245
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g07450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G38630AT Annotation by Michelle Graham. TAIR10: cytochrome B561-1 | chr5:15466141-15467511 FORWARD LENGTH=230 SoyBaseE_val: 1.00E-58ISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0008805GO-mf Annotation by Michelle Graham. GO Molecular Function: carbon-monoxide oxygenase activity SoyBaseN/AISS
PTHR10106Panther CYTOCHROME B561 JGI ISS
PF03188PFAM Eukaryotic cytochrome b561 JGI ISS
UniRef100_G7ZY50UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b561 n=1 Tax=Medicago truncatula RepID=G7ZY50_MEDTR SoyBaseE_val: 1.00E-66ISS
UniRef100_I1LX08UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LX08_SOYBN SoyBaseE_val: 6.00E-93ISS

Expression Patterns of Glyma13g07450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g07450 not represented in the dataset
Glyma13g07450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g07450
ParalogEvidenceComments
Glyma19g05890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g07450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g047600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g07450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g07450
>Glyma13g07450.2   sequence type=CDS   gene model=Glyma13g07450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAGTATCTCTGAGAATTTGGTCTTTAACCAAACACTATCTGGAACTAAAAACTTCAAAAAAGCAATTCATCTTGCGTTACAGTTTGTTGCTCTCATTTTGAGCTTGATTGGTGTTTGGGCTGCTCGGATGTTTCACATTGACAAGGGCATTGACAATTTCTACTGCCTGCATTCATGGCTAGGCCTTGCATGCCTTTTCCTATTCATCATCCAGCGAGGTGCTGGCTTTGCAACATTTTGGTACCCCAGAGGGTCAAGAAATAGTAGAGCTGCCTTATTGTCGTGGCATGTGTTCTTTGGTATCTATATCTATGCCTTGGCTATAGCCACAGTTGCTACTAGTATTCTAGAAAAAAGCTACATTATTTCAGAAGGTTTGCTGATAGTCATTTTAGGTGGTTTTGTGATTCTTGGAATTGTTACTCATGTTTATGGTAAAGCTGATGTCACAAGGGGAAACGAGTAA
Predicted protein sequences of Glyma13g07450
>Glyma13g07450.2   sequence type=predicted peptide   gene model=Glyma13g07450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSISENLVFNQTLSGTKNFKKAIHLALQFVALILSLIGVWAARMFHIDKGIDNFYCLHSWLGLACLFLFIIQRGAGFATFWYPRGSRNSRAALLSWHVFFGIYIYALAIATVATSILEKSYIISEGLLIVILGGFVILGIVTHVYGKADVTRGNE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo