SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g06671

Feature Type:gene_model
Chromosome:Gm13
Start:6823867
stop:6824525
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g06671
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15630AT Annotation by Michelle Graham. TAIR10: COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family | chr5:5084842-5086545 FORWARD LENGTH=431 SoyBaseE_val: 5.00E-111ISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0009834GO-bp Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0044036GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
UniRef100_Q69F97UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phytochelatin synthetase-like protein n=1 Tax=Phaseolus vulgaris RepID=Q69F97_PHAVU SoyBaseE_val: 2.00E-114ISS
UniRef100_UPI000233AB23UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AB23 related cluster n=1 Tax=unknown RepID=UPI000233AB23 SoyBaseE_val: 7.00E-136ISS

Expression Patterns of Glyma13g06671
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g06671 not represented in the dataset
Glyma13g06671 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g06671 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g053200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g06671
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g06671
>Glyma13g06671.1   sequence type=CDS   gene model=Glyma13g06671   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGGGGAGACTCCAAAATTCTCAGCATGGTGGGGGTTCATACTCCAAAGAAAGACAATGAACCATTGCTGCAGTGCACTCATCACATGTGTCCAATCAGGGTCCACTGGCATGTAAAGACTAACTACAAGGACTATTGGCGAGTCAAGGTTGCTATAACAAACTTCAATTACAGGATGAATCACTCCCTCTGGTCTCTTGCTGTTCAGCATCCAAATCTCAACAATCTCACCCAAGTTTTCAGTTTCAATTACAAGCCTCTTCTTCCCTATGGATCCATAAATGACACTGGCATGTTCTATGGCATGAAGTACTTCAATGATCTTCTAATGGAAGCTGGACCAACTGGGAATGTTCAATCAGAGTTACTTCTTCAGAAGGACAAGGATACATTCACATTCAAGCAGGGTTGGGCATTTCCTCGCAAGGTCTACTTTAATGGTGATGAATGCATGCTGCCCCCACCTGACGCCTACCCTTTTCTCCCTAACTCTGCACCTGCAAGCCTACTTAACTTCCCTGCATTCATTTTCTTGTTGCTTTTCTTGCTATCAGTTTGGTGA
Predicted protein sequences of Glyma13g06671
>Glyma13g06671.1   sequence type=predicted peptide   gene model=Glyma13g06671   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RGDSKILSMVGVHTPKKDNEPLLQCTHHMCPIRVHWHVKTNYKDYWRVKVAITNFNYRMNHSLWSLAVQHPNLNNLTQVFSFNYKPLLPYGSINDTGMFYGMKYFNDLLMEAGPTGNVQSELLLQKDKDTFTFKQGWAFPRKVYFNGDECMLPPPDAYPFLPNSAPASLLNFPAFIFLLLFLLSVW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo