SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g06130

Feature Type:gene_model
Chromosome:Gm13
Start:6424991
stop:6425862
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g06130
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G29370AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G39240.1); Has 16 Blast hits to 16 proteins in 5 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 16; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:11278652-11278957 FORWARD LENGTH=101 SoyBaseE_val: 5.00E-13ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1LWS0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWS0_SOYBN SoyBaseE_val: 1.00E-81ISS

Expression Patterns of Glyma13g06130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g06130
ParalogEvidenceComments
Glyma19g03570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g06130 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g057000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g06130
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g06130
>Glyma13g06130.1   sequence type=CDS   gene model=Glyma13g06130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCACAATCACTAGGCACAGTTACAAGCTCTCCCTCAAAAGAGCCACAAAGAGAATAACAAGAAGGAGAAGAAGAAACCCACATAACCACCGAAAAAGAAGCACCAGCACCACGATTGACCCTTTCAAACCAAAGTGCAGTAATAATAATAAGGTTTGTGAAAAGCTTGAAACTCTGAAGAACCTCATCCCCGGTGGAGAAGAAGCGGTGAAACCCGACCAGCTGTTCAAGGAAACCGCGGAGTACATCGTGTTGCTGCGGACGCGCGTCGTGGTTCTCCAGAAGCTCATTGAGTATTATGGGAACAAGGACGACACCCAGGATGAGAATGAACATGATGCTGTCTTGTTCTCATAG
Predicted protein sequences of Glyma13g06130
>Glyma13g06130.1   sequence type=predicted peptide   gene model=Glyma13g06130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTTITRHSYKLSLKRATKRITRRRRRNPHNHRKRSTSTTIDPFKPKCSNNNKVCEKLETLKNLIPGGEEAVKPDQLFKETAEYIVLLRTRVVVLQKLIEYYGNKDDTQDENEHDAVLFS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo