SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g06070

Feature Type:gene_model
Chromosome:Gm13
Start:6365626
stop:6367727
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g06070
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G02080AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S19e family protein | chr3:364138-365161 REVERSE LENGTH=143 SoyBaseE_val: 5.00E-92ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3411 KOG 40S ribosomal protein S19 JGI ISS
PTHR11710Panther 40S RIBOSOMAL PROTEIN S19 JGI ISS
PF01090PFAM Ribosomal protein S19e JGI ISS
UniRef100_B7FHE5UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S19-1 n=1 Tax=Medicago truncatula RepID=B7FHE5_MEDTR SoyBaseE_val: 9.00E-91ISS
UniRef100_I1LWR7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWR7_SOYBN SoyBaseE_val: 6.00E-101ISS

Expression Patterns of Glyma13g06070
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g06070
ParalogEvidenceComments
Glyma19g03520 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g06070 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g057500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g06070
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g06070
>Glyma13g06070.1   sequence type=CDS   gene model=Glyma13g06070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACCGCGAGGACCGTGAAGGATGTTTCGCCTCACGATTTCGTGAAGGCTTACGCCTCCCATCTCAAGCGTTCCGGCAAGATGGAGCTTCCTGAGTGGACTGATATTGTAAAAACAGCAAAATTTAAGGAATTGGCTCCATATGATCCTGACTGGTATTATGTTAGGGCTGCCTCAATGGCAAGAAAGATTTATTTGAGAGGCGGTCTTGGTGTTGGGGCTTTCCAGAGGATCTATGGTGGAAGCAAGAGAAATGGAAGCCGTCCCCCACATTTCTGCAAGAGCAGTGGGGCTATTGCAAGACACATTCTGCAACAATTGCAAAACATGAGCATTGTTGAGATTGATACAAAAGGAGGTAGGAAAATCACATCTAGTGGTCGAAGGGATCTTGATCAAGTTGCTGGGCGAATTGTGGTTGCTGCCTGA
Predicted protein sequences of Glyma13g06070
>Glyma13g06070.1   sequence type=predicted peptide   gene model=Glyma13g06070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATARTVKDVSPHDFVKAYASHLKRSGKMELPEWTDIVKTAKFKELAPYDPDWYYVRAASMARKIYLRGGLGVGAFQRIYGGSKRNGSRPPHFCKSSGAIARHILQQLQNMSIVEIDTKGGRKITSSGRRDLDQVAGRIVVAA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo