Glyma13g05810 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g05810

Feature Type:	gene_model
Chromosome:	Gm13
Start:	6136796
stop:	6139218
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g05810

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G15350	AT	Annotation by Michelle Graham. TAIR10: early nodulin-like protein 17 \| chr5:4985184-4986154 REVERSE LENGTH=172	SoyBase	E_val: 7.00E-68	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0052541	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall cellulose metabolic process	SoyBase	N/A	ISS
GO:0052546	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall pectin metabolic process	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0046658	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF02298	PFAM	Plastocyanin-like domain	JGI		ISS
UniRef100_I1LWP0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWP0_SOYBN	SoyBase	E_val: 1.00E-122	ISS
UniRef100_Q2HW94	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Blue (Type 1) copper domain n=1 Tax=Medicago truncatula RepID=Q2HW94_MEDTR	SoyBase	E_val: 6.00E-85	ISS

Expression Patterns of Glyma13g05810

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g05810 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g059500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g05810

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g05810

Limit To All Plant Sequences

>Glyma13g05810.1   sequence type=CDS   gene model=Glyma13g05810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAGGATGAAGAGGGTGCTTCTGCTGCTTCTGGCCTTCACTGTTCTTCTCATGTTGCCAGAAGCTTCTGCTACAAAGTTTACTGTTGGAAACAACCAGTTTTGGAACCCCAATATTAACTACACTGAGTGGGCTAAAGGCAAACATTTCTACCTTGGTGACTGGCTCTATTTTGTGTACGATAGGAACCAAGCGAGCGTGTTGGAAGTGAACAAGACAGATTATGAAACATGTAACTCTGATCATCCACTCACAAATTGGACTAGGGGAGCTGGAAGAGACGTGGTTCCATTGAATGTAACAAAAACTTACTACATTATCAGTGGCCGAGGGTTCTGCTTCAGCGGCATGAAGATAGCAGTTCATGTTGAAAAGCTGCCACCTCCACCAAAAGCTGCCCCTGTAAAGTCCGCGGCACCGACCCTTTTTTCACAAGACCGCATTCTTCTCATGCCTGTTGTTTTTGCCATTGGAGCAGCATGGGATGCATTCATTCATTTCTGGTAG

Predicted protein sequences of Glyma13g05810

Limit To All Plant Sequences

>Glyma13g05810.1   sequence type=predicted peptide   gene model=Glyma13g05810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MERMKRVLLLLLAFTVLLMLPEASATKFTVGNNQFWNPNINYTEWAKGKHFYLGDWLYFVYDRNQASVLEVNKTDYETCNSDHPLTNWTRGAGRDVVPLNVTKTYYIISGRGFCFSGMKIAVHVEKLPPPPKAAPVKSAAPTLFSQDRILLMPVVFAIGAAWDAFIHFW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain