SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g05610): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g05610): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g05610

Feature Type:gene_model
Chromosome:Gm13
Start:5962847
stop:5968093
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26690AT Annotation by Michelle Graham. TAIR10: emp24/gp25L/p24 family/GOLD family protein | chr1:9224299-9225682 REVERSE LENGTH=214 SoyBaseE_val: 1.00E-90ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0008320GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transmembrane transporter activity SoyBaseN/AISS
KOG1691 KOG emp24/gp25L/p24 family of membrane trafficking proteins JGI ISS
PTHR22811Panther COPII-COATED VESICLE MEMBRANE PROTEIN JGI ISS
PTHR22811:SF5Panther EMP24/GP25L-RELATED JGI ISS
PF01105PFAM emp24/gp25L/p24 family/GOLD JGI ISS
UniRef100_G7KKY5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane emp24 domain-containing protein n=1 Tax=Medicago truncatula RepID=G7KKY5_MEDTR SoyBaseE_val: 2.00E-120ISS
UniRef100_I1LWM1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWM1_SOYBN SoyBaseE_val: 2.00E-160ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g05610 not represented in the dataset

Glyma13g05610 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g03020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g061200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g05610.1   sequence type=CDS   gene model=Glyma13g05610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCAATGTCCGATTCGGTTCGTTCCCTCGCACTTCTCTCCCTTGCAGTGATGTGTAGCGTCGCGAATTCGATGCGGTTCGACCTTCAATCGGGTCAAACCAAGTGCATTTCAGAGGACATTAAGACTAACGCGATGAGCGTGGGAAAGTACAGTGTCGTTAATCCCCAAGAAGGTTACCCACTTCCCGATTCCCACAGGATCATTGTCAAGGTGACGTCGCCTCATGCGCACACATATCACTTTGGAGATCATGTGGATTCTGGTAATTATGCATTTACGGCATCTGAGGCTGGTGACTACTCAGCTTGCTTTTGGGTACAGGATACCAGGGATGCCCCGTCGGTGGTAACTATTGAATTTGAGTGGAGAACTGGGGTTGCTGCCAAAGATTGGTCAAAGGTTGCCAAGAAAGGGCAGATTGAAGTAATGGAATTTGAGTTGAAGAAGCTATATGATACTGTCCTATCCATCCATGACGAGATGTTTTATCTTCGAGAAAGGGAGGAAGAGATGCAAGATCTTAACAAAGCAACAAACAGCAAGATGTTTACCTTCAGTTTCCTTTCGATTGTGGTTTGCTTGTCTGTGGCTGGTTTGCAACTATGGCATTTGAAGACATTCTTTGAGAGGAAGAAGCTCCTCTAA

>Glyma13g05610.1   sequence type=predicted peptide   gene model=Glyma13g05610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAMSDSVRSLALLSLAVMCSVANSMRFDLQSGQTKCISEDIKTNAMSVGKYSVVNPQEGYPLPDSHRIIVKVTSPHAHTYHFGDHVDSGNYAFTASEAGDYSACFWVQDTRDAPSVVTIEFEWRTGVAAKDWSKVAKKGQIEVMEFELKKLYDTVLSIHDEMFYLREREEEMQDLNKATNSKMFTFSFLSIVVCLSVAGLQLWHLKTFFERKKLL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo