Glyma13g05531 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g05531

Feature Type:	gene_model
Chromosome:	Gm13
Start:	5841116
stop:	5842062
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g05531

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G29034	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 7 Blast hits to 7 proteins in 3 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 7; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr3:11030343-11030603 REVERSE LENGTH=86	SoyBase	E_val: 6.00E-16	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1LWL5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWL5_SOYBN	SoyBase	E_val: 9.00E-27	ISS

Expression Patterns of Glyma13g05531

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g05531 not represented in the dataset	Glyma13g05531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g05531 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g062100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g05531

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g05531

Limit To All Plant Sequences

>Glyma13g05531.1   sequence type=CDS   gene model=Glyma13g05531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCAGAACATGATGGCTCTTTTGATTGGATTAATTGGTGCAGCCCTCACTTTATTTGCTTACTCACAAACCTTCGTATCACCAGGTCAATGCATCACACTTGGTCTTATTGTCCTCATGTTGGGCTTGCTTGTAGGAGAAGGTCTGATATCTTTCTAA

Predicted protein sequences of Glyma13g05531

Limit To All Plant Sequences

>Glyma13g05531.1   sequence type=predicted peptide   gene model=Glyma13g05531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQNMMALLIGLIGAALTLFAYSQTFVSPGQCITLGLIVLMLGLLVGEGLISF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain