Report for Sequence Feature Glyma13g05280
Feature Type: gene_model
Chromosome: Gm13
Start: 5525020
stop: 5527661
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g05280
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G28857 AT
Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding family protein | chr3:10855781-10856313 REVERSE LENGTH=92
SoyBase E_val: 3.00E-43 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
PTHR12565 Panther
STEROL REGULATORY ELEMENT-BINDING PROTEIN
JGI ISS
PTHR12565:SF8 Panther
UPSTREAM TRANSCRIPTION FACTOR
JGI ISS
PF00010 PFAM
Helix-loop-helix DNA-binding domain
JGI ISS
UniRef100_B9RUP9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription regulator, putative n=1 Tax=Ricinus communis RepID=B9RUP9_RICCO
SoyBase E_val: 4.00E-45 ISS
UniRef100_UPI0000E649EF UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0000E649EF related cluster n=1 Tax=unknown RepID=UPI0000E649EF
SoyBase E_val: 3.00E-54 ISS
Expression Patterns of Glyma13g05280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma13g05280
Paralog Evidence Comments
Glyma19g02510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g05280 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g063800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g05280
Coding sequences of Glyma13g05280
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g05280.1 sequence type=CDS gene model=Glyma13g05280 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTAGCAGAAGGTCCAGGCAGCAATCTGCATCCACAAGGATCTCCGATGACCAAATCATCGACCTTGTTTCCAAGTTGCGTCAACTTGTTCCTGAGATTCGCGATAGGCGTTCTGATAAGGTATCAGCATCTAAGGTCCTACAAGAGACCTGTAACTACATCAGAAGCTTACACAGAGAAGTGGATGACCTAAGCGAACGACTGTCTCAGTTGTTGGCCACAATCGATGCTGATAGCCCTGAAGCTGCCATCATTAGGAGCCTAATTAACTAA
Predicted protein sequences of Glyma13g05280
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g05280.1 sequence type=predicted peptide gene model=Glyma13g05280 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSSRRSRQQSASTRISDDQIIDLVSKLRQLVPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSQLLATIDADSPEAAIIRSLIN*