SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g04825

Feature Type:gene_model
Chromosome:Gm13
Start:5082573
stop:5084210
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15020AT Annotation by Michelle Graham. TAIR10: SIN3-like 2 | chr5:4859408-4865569 REVERSE LENGTH=1355 SoyBaseE_val: 2.00E-36ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4204 KOG Histone deacetylase complex, SIN3 component JGI ISS
PTHR12346Panther SIN3B-RELATED JGI ISS
PF02671PFAM Paired amphipathic helix repeat JGI ISS
UniRef100_G7KJX2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Paired amphipathic helix protein Sin3 n=1 Tax=Medicago truncatula RepID=G7KJX2_MEDTR SoyBaseE_val: 1.00E-36ISS
UniRef100_I1LWG1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWG1_SOYBN SoyBaseE_val: 7.00E-40ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g04825 not represented in the dataset

Glyma13g04825 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g067600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g04825.1   sequence type=CDS   gene model=Glyma13g04825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACGCGGCTTTGGACAAAACCAAGTCCCTGGAAGTGGCAATGGTGGTGATGTTTGTCGGGGAGCAACTACTTCCCAAAAACTAACTATAATTGATGCCGTATCCTATTTAAAGGAAGTCAAAGTGGTGTTTATGGACCAAGTGGTGAAGTATGACATGTTTTGTGAAATCTTGATAGATTTCAAGGCTAAAAGGGTTAACATTTATGATGTCATAAAAAGGGTGAAGGAGTTATTCAAAGGGCACAACAATTTGATTTTGGGATTTCAAACTTTTCTGCCAAAGGGTTATAAGATAACATTTGACAAGGATGAGGCTCCTTCGAACTTTGGACAAAACCAAGTCCCTGGAAGTGGCAATGGTGGTGATGTTTGTGGGGGAGCAACTACTTCCAAAGAAGTGACTGCCGCTGATGCCTTATCCTATTTGTGGGAAGTCAAAGCAGCATTTCAGGACCAAAGGGAGAAGTATAACATGTTCATTGAGATCATGAAAGATTTCGAGGCTCGAAGGATTCGCACTAATGCTGTCATAACAAGGGTGAAGGAGTTATTCAAAGGGCACAACAATTTGATTTTGGGATTTCAAACTTTTCTACCAGAAGGTTATGAGATAACAACTGACAAGGATGATGCTCCACCAAAGTAA

>Glyma13g04825.1   sequence type=predicted peptide   gene model=Glyma13g04825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MERGFGQNQVPGSGNGGDVCRGATTSQKLTIIDAVSYLKEVKVVFMDQVVKYDMFCEILIDFKAKRVNIYDVIKRVKELFKGHNNLILGFQTFLPKGYKITFDKDEAPSNFGQNQVPGSGNGGDVCGGATTSKEVTAADALSYLWEVKAAFQDQREKYNMFIEIMKDFEARRIRTNAVITRVKELFKGHNNLILGFQTFLPEGYEITTDKDDAPPK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo