SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g04630

Feature Type:gene_model
Chromosome:Gm13
Start:4936596
stop:4938693
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g04630
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G28210AT Annotation by Michelle Graham. TAIR10: zinc finger (AN1-like) family protein | chr3:10520585-10521223 FORWARD LENGTH=186 SoyBaseE_val: 6.00E-72ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR14677Panther ARSENITE INDUCUBLE RNA ASSOCIATED PROTEIN AIP-1-RELATED JGI ISS
PF01428PFAM AN1-like Zinc finger JGI ISS
UniRef100_B3IX35UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor C2H2 n=1 Tax=Lotus japonicus RepID=B3IX35_LOTJA SoyBaseE_val: 4.00E-100ISS
UniRef100_I1LWF2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWF2_SOYBN SoyBaseE_val: 5.00E-139ISS

Expression Patterns of Glyma13g04630
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g04630
ParalogEvidenceComments
Glyma19g01640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g04630 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g069200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g04630
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g04630
>Glyma13g04630.1   sequence type=CDS   gene model=Glyma13g04630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCGGGTGGAACAGAAGCTTTTCCAGATTTGGGTAAACACTGCCAGCACCGCGATTGCAACCAGCTCGATTTTCTTCCTTTCACCTGCGACGGTTGCCAACAGATCTTTTGTTTGGAACACAGATCCTACAAGTCCCACGCGTGCCTGAAATCCGACCACAACAGCAGAAAGGTTGTTGTTTGCGAAGCATGTTCCATGTCCATCGAGACCACCGGCCATGTGGGACAAGACGAGGAGGCAATCTTGCAGAAGCACCTCAAGTCTGGTAATTGTGACCCTACCAAGAAGAAGAAACCAATTTGTCCCGTCAAGCGTTGCAGGGAGGTTTTGACGTTTTCCAACACCAGCACATGTAAAACTTGCCACATTAAGGTGTGCCTCAAGCATCGTTTCCCTGCTGATCATGCCTGTAGCAGAGGAGCTTCAGCTTCTTCATCAGCTTGTGTTTCTAATGGTTTGTGGAACAATCGGTTCTTGACTGCTTTTGCCAAGAGGACTGGACAAGAATGTGCCAAAAATGGTGCAACTTGTTCTACTTCTCCTCCTAGTACACCTTCTGTTAAGGCCTATTGA
Predicted protein sequences of Glyma13g04630
>Glyma13g04630.1   sequence type=predicted peptide   gene model=Glyma13g04630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASGGTEAFPDLGKHCQHRDCNQLDFLPFTCDGCQQIFCLEHRSYKSHACLKSDHNSRKVVVCEACSMSIETTGHVGQDEEAILQKHLKSGNCDPTKKKKPICPVKRCREVLTFSNTSTCKTCHIKVCLKHRFPADHACSRGASASSSACVSNGLWNNRFLTAFAKRTGQECAKNGATCSTSPPSTPSVKAY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo