SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g04420

Feature Type:gene_model
Chromosome:Gm13
Start:4750754
stop:4752019
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g04420
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40190AT Annotation by Michelle Graham. TAIR10: RNA ligase/cyclic nucleotide phosphodiesterase family protein | chr5:16069298-16069849 REVERSE LENGTH=183 SoyBaseE_val: 3.00E-75ISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0016070GO-bp Annotation by Michelle Graham. GO Biological Process: RNA metabolic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
UniRef100_B9RUD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin binding protein, putative n=1 Tax=Ricinus communis RepID=B9RUD3_RICCO SoyBaseE_val: 2.00E-92ISS
UniRef100_I1LWD7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWD7_SOYBN SoyBaseE_val: 2.00E-128ISS

Expression Patterns of Glyma13g04420
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g04420
ParalogEvidenceComments
Glyma19g01490 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g04420 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g070800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g04420
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g04420
>Glyma13g04420.1   sequence type=CDS   gene model=Glyma13g04420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGCAGCAAGGGTTCGCGATCGAGCTATACTTAGAGCCAGCGCTGGAGAATCAGGTTCTGAAAGCATGGAACGTTCTGGCGCGGAGACAAATCAGCACAGAGCTGATAGAAATGGAGTCTCGGCCACACATAACCCTATTCTCGGCACCATTTCTAGAACCTTCCAAGCTCGATTCTCTCCTAAAAGTGTTCGCCTCCAAGCACGACCCTCTCCCTCTCACTTTCTCATCCCTCGCCACTTTCCCCAACAACCTCCTCTTCCTCGCCCCAACCCCTTCCCTCTCCCTCCTCCACTTTCAGTCACAGCTCTGTGACGCTATCAGAAAAGAAGGCATCGAAATCGCTCATGAATTTGCTTTCAATTCGTGGATCCCTTATTGCTCCGTTGCGCACCATGTCCCCCAAAACAGAATGCCTGAGGCTTTCTCACTCTTGAGGGAACTGAAGCTTCCGGTTTCCGGTTACGCTATGGATGTTGCGCTCGTACAGTTCTCTCCGGTTCGGGAAATCTTCTCGTTTGTGCTCGGCAACAACGTAGACTCGTGA
Predicted protein sequences of Glyma13g04420
>Glyma13g04420.1   sequence type=predicted peptide   gene model=Glyma13g04420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSQQGFAIELYLEPALENQVLKAWNVLARRQISTELIEMESRPHITLFSAPFLEPSKLDSLLKVFASKHDPLPLTFSSLATFPNNLLFLAPTPSLSLLHFQSQLCDAIRKEGIEIAHEFAFNSWIPYCSVAHHVPQNRMPEAFSLLRELKLPVSGYAMDVALVQFSPVREIFSFVLGNNVDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo