SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g04401

Feature Type:gene_model
Chromosome:Gm13
Start:4735067
stop:4739253
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g04401
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38280AT Annotation by Michelle Graham. TAIR10: AMP deaminase, putative / myoadenylate deaminase, putative | chr2:16033767-16038793 REVERSE LENGTH=839 SoyBaseE_val: 8.00E-63ISS
GO:0006188GO-bp Annotation by Michelle Graham. GO Biological Process: IMP biosynthetic process SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0009168GO-bp Annotation by Michelle Graham. GO Biological Process: purine ribonucleoside monophosphate biosynthetic process SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009880GO-bp Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0010564GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0031307GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to mitochondrial outer membrane SoyBaseN/AISS
GO:0043231GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular membrane-bounded organelle SoyBaseN/AISS
GO:0003876GO-mf Annotation by Michelle Graham. GO Molecular Function: AMP deaminase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0019239GO-mf Annotation by Michelle Graham. GO Molecular Function: deaminase activity SoyBaseN/AISS
GO:0043424GO-mf Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase binding SoyBaseN/AISS
PTHR11359Panther AMP DEAMINASE JGI ISS
PF00962PFAM Adenosine/AMP deaminase JGI ISS
UniRef100_B9T1I5UniRef Annotation by Michelle Graham. Most informative UniRef hit: AMP deaminase, putative n=1 Tax=Ricinus communis RepID=B9T1I5_RICCO SoyBaseE_val: 3.00E-62ISS
UniRef100_UPI00023376A7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023376A7 related cluster n=1 Tax=unknown RepID=UPI00023376A7 SoyBaseE_val: 1.00E-65ISS

Expression Patterns of Glyma13g04401
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g04401 not represented in the dataset
Glyma13g04401 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g04401 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma13g04401
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g04401
>Glyma13g04401.1   sequence type=CDS   gene model=Glyma13g04401   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGTTCTTATAAATGTCTTGCTGCTTCCACGGTTGTACAATGTGTACAAAGAAATGGGAATTGTGACATCATTCCAGAACATGCTCAACAATATTTTCATTCCACTTTTTGAGGTCACTGTCAACCCAGATTCACATCCTCAGCTGCATGTTTTCCTGAAACAGGTGTCCAAAGATGAAGTGTCTTTAGATTTGTCCTCCAAAGATGGTAGTCCTCCAAAGATGAACAATAACTCCCTATTCTTAGACTACCATCGGAATCCTTTTCCAATGTTCTTCTTACGGGGTCTGAATGTGTCACTTTCTACTGATGATCCTCTCCAAATTCACTTAACAAAGGAACCATTGGTTGAAGAATATAGCATAGCTGCTTCTGTGTGGAAGTTGAGCTCATGTAATTTATGTGAGATTGCCCATAATTCAGTTTATCAATCAGGTTTCTCACATGCTTTAAAGTCACATTGGATTGGTAAGGAGTACTTCAAGAGTGGGTCACGCGAAAATGACATTCAGAGAACAAACATTCCTCACATCCGGTTGGAATTCCGTGATAAGAAAGTCACGTATACTAAGACGGTTATCAGAACCGTCGTTATATTTTTTCGCCATTTTACGACACCACTTTTTACGATGGTTTAA
Predicted protein sequences of Glyma13g04401
>Glyma13g04401.1   sequence type=predicted peptide   gene model=Glyma13g04401   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVLINVLLLPRLYNVYKEMGIVTSFQNMLNNIFIPLFEVTVNPDSHPQLHVFLKQVSKDEVSLDLSSKDGSPPKMNNNSLFLDYHRNPFPMFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSSCNLCEIAHNSVYQSGFSHALKSHWIGKEYFKSGSRENDIQRTNIPHIRLEFRDKKVTYTKTVIRTVVIFFRHFTTPLFTMV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo