|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G21390 | AT | Annotation by Michelle Graham. TAIR10: Coatomer, alpha subunit | chr2:9152428-9156577 FORWARD LENGTH=1218 | SoyBase | E_val: 2.00E-35 | ISS |
GO:0000226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization | SoyBase | N/A | ISS |
GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
GO:0006511 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
GO:0006886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular protein transport | SoyBase | N/A | ISS |
GO:0006888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport | SoyBase | N/A | ISS |
GO:0009853 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photorespiration | SoyBase | N/A | ISS |
GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
GO:0051788 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to misfolded protein | SoyBase | N/A | ISS |
GO:0080129 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0030117 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane coat | SoyBase | N/A | ISS |
GO:0030126 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: COPI vesicle coat | SoyBase | N/A | ISS |
GO:0080008 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex | SoyBase | N/A | ISS |
GO:0005198 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural molecule activity | SoyBase | N/A | ISS |
GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
PTHR19876 | Panther | COATOMER | JGI | ISS | |
PTHR19876:SF1 | Panther | COATOMER BETA SUBUNIT | JGI | ISS | |
PF00400 | PFAM | WD domain, G-beta repeat | JGI | ISS | |
UniRef100_I0Z956 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Coatomer, alpha subunit n=1 Tax=Coccomyxa subellipsoidea C-169 RepID=I0Z956_9CHLO | SoyBase | E_val: 8.00E-35 | ISS |
UniRef100_I3SJ96 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Lotus japonicus RepID=I3SJ96_LOTJA | SoyBase | E_val: 2.00E-36 | ISS |
Glyma13g04341 not represented in the dataset |
Glyma13g04341 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.13g071500 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g04341.1 sequence type=CDS gene model=Glyma13g04341 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAATTTGAGACAAAGAGTAACAGAGTGAAGGGCCTGAGTTTCCATCCGAAGCAGCCATGGATCCTGGCGAGTCTCCACAACGGCGTCATCCAACTCTGGGACTACCGCATTGGAACCCTTATCGACAAGTTTGACGAGCACGACGACCCCGTCCATGGTGTCCATTTCCACCACTCCCAGCCTCTCTTCGTCTCCTGA
>Glyma13g04341.1 sequence type=predicted peptide gene model=Glyma13g04341 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKFETKSNRVKGLSFHPKQPWILASLHNGVIQLWDYRIGTLIDKFDEHDDPVHGVHFHHSQPLFVS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||