Glyma13g04190 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g04190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g04190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g04190

Feature Type:	gene_model
Chromosome:	Gm13
Start:	4543314
stop:	4545271
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g04190

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G79690	AT	Annotation by Michelle Graham. TAIR10: nudix hydrolase homolog 3 \| chr1:29985360-29990171 FORWARD LENGTH=772	SoyBase	E_val: 5.00E-53	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008239	GO-mf	Annotation by Michelle Graham. GO Molecular Function: dipeptidyl-peptidase activity	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
PTHR23422	Panther	DIPEPTIDYL PEPTIDASE III-RELATED	JGI		ISS
PTHR23422:SF4	Panther	NUDIX HYDROLASE-RELATED	JGI		ISS
UniRef100_I1LWC8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LWC8_SOYBN	SoyBase	E_val: 2.00E-80	ISS
UniRef100_Q6K683	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: MutT/nudix protein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q6K683_ORYSJ	SoyBase	E_val: 9.00E-51	ISS

Expression Patterns of Glyma13g04190

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g04190 not represented in the dataset	Glyma13g04190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g04190 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g072300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g04190

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g04190

Limit To All Plant Sequences

>Glyma13g04190.1   sequence type=CDS   gene model=Glyma13g04190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATGTTTCTTTTCTTGCGGGATGCTTCCGGTCAGTGCGTTTTGGTTTAGAGGAAGCTCATGGAAAAGGACAAGCATTGCAGTTCAACTGGTTATATGAGAAAGGAGCCTTTGTCTGGGATTCTGAAGGCAAAGTCTCTGTTGATTTTACCAAGATTGAAGGAGCAGTTGAAAGCCTGAGCAGGGAGATACTCACCATACAAGCCAATGGTGATAAAGAGACTGCTGGTTTGCTTCTCCTGAAATACTGTGTGTTGACAGAACCACTAAAAGTTGCTCTAAAAAATTTGGAGGATATTCAGGTACCTGTTGATGTAGCTCCGACATTTCCCATTGGCAACAAAATATTGCAATGA

Predicted protein sequences of Glyma13g04190

Limit To All Plant Sequences

>Glyma13g04190.1   sequence type=predicted peptide   gene model=Glyma13g04190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYVSFLAGCFRSVRFGLEEAHGKGQALQFNWLYEKGAFVWDSEGKVSVDFTKIEGAVESLSREILTIQANGDKETAGLLLLKYCVLTEPLKVALKNLEDIQVPVDVAPTFPIGNKILQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain