SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g03820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g03820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g03820

Feature Type:gene_model
Chromosome:Gm13
Start:3966468
stop:3969869
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62730AT Annotation by Michelle Graham. TAIR10: Terpenoid synthases superfamily protein | chr1:23229204-23230118 REVERSE LENGTH=304 SoyBaseE_val: 4.00E-159ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
KOG4411 KOG Phytoene/squalene synthetase JGI ISS
PTHR21181Panther FAMILY NOT NAMED JGI ISS
PTHR21181:SF4Panther gb def: F23N19.9 (Hypothetical protein) JGI ISS
PF00494PFAM Squalene/phytoene synthase JGI ISS
UniRef100_B6TWB6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phytoene synthase n=1 Tax=Zea mays RepID=B6TWB6_MAIZE SoyBaseE_val: 3.00E-122ISS
UniRef100_I1LWA3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LWA3_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g03820 not represented in the dataset

Glyma13g03820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g075600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g03820.1   sequence type=CDS   gene model=Glyma13g03820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGGCGGTTCTGCATCTAGTAACTTAAGGGCAGCTCTCTCCCATTGCGTACAACAAGTGCGAAGTTATGATTATCATCACTATCTTTGCCTTCTCGAGCTGCCTCCGTCTATGCGGAAGGCTGCATTTGCACTCCGTGCCTTGAATGTTGAAACAGCGAGGGCTATGGATGTTGCCTCAGATCCCAGGATCGGCCTTATGCGCCTTGTTTGGTGGCAGGAAGCCATAGACAAAATGTTCGCCAATAAACTGATTGAACACCCAACAGCACAGGCCCTGTCATCTGTGATAGCTGAGACCAAACTCAGCAAGATATGGTTGAAACGATCTGTTGATGCTCGGATCAATGATGCAAGAAGAGAGGTTACTGACATGCCCAAAACTATTGGAGAGTTGGAGAAATATGCCGAGGACACTGTATCAACTATGCTGTACCTAACACTTCAAGCTGGTGGTATCAAGTCTACCGCAGCTGACCATGCAGCCTCACATATTGGCAAGGCTAGTGGCATTCTCTTGCTCCTTAAATCATTGCCCTATCATGCGTCTCACAACCGGCATTTTTCTTACATACCAACTGCAATAGCATCCAAGCATGGGCTAATAGTTAAGCAGGGAGGTGGAGAAGAGAGATGGGTGGATTCTCGCGAAGGCCTTTGTGAAGCAGTTTATGAAATGGCATCAGTAGCCAATGCACACTTAGAGAAGGCCCGGAAGTTAACCGAAAGTGTACCTCCTGAGGCTCTTCCAGTGCTCCTTCCAGCAGTGCCTGCTCAGGTTCTCTTGGATTCCCTAAGAAAGGTCCAATTTGATGTGTTTGACTCAAAGCTAACAAGAGGGGTGCTGGGAATACCTCCTTTGTGGTACCAGCTTAAGCTCAAGTGGACGTCATGGAGAAGGAAATACTAA

>Glyma13g03820.1   sequence type=predicted peptide   gene model=Glyma13g03820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNGGSASSNLRAALSHCVQQVRSYDYHHYLCLLELPPSMRKAAFALRALNVETARAMDVASDPRIGLMRLVWWQEAIDKMFANKLIEHPTAQALSSVIAETKLSKIWLKRSVDARINDARREVTDMPKTIGELEKYAEDTVSTMLYLTLQAGGIKSTAADHAASHIGKASGILLLLKSLPYHASHNRHFSYIPTAIASKHGLIVKQGGGEERWVDSREGLCEAVYEMASVANAHLEKARKLTESVPPEALPVLLPAVPAQVLLDSLRKVQFDVFDSKLTRGVLGIPPLWYQLKLKWTSWRRKY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo