SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g03730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g03730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g03730

Feature Type:gene_model
Chromosome:Gm13
Start:3756987
stop:3758459
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g03730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G26670AT Annotation by Michelle Graham. TAIR10: Pectinacetylesterase family protein | chr5:9319096-9320816 FORWARD LENGTH=298 SoyBaseE_val: 2.00E-25ISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
PTHR21562Panther NOTUM-RELATED JGI ISS
PTHR21562:SF1Panther PECTIN ACETYLESTERASE JGI ISS
PF03283PFAM Pectinacetylesterase JGI ISS
UniRef100_G7IAD4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pectin acetylesterase n=1 Tax=Medicago truncatula RepID=G7IAD4_MEDTR SoyBaseE_val: 5.00E-27ISS
UniRef100_I1NET3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NET3_SOYBN SoyBaseE_val: 2.00E-32ISS

Expression Patterns of Glyma13g03730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g03730 not represented in the dataset
Glyma13g03730 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g03730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma13g03730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g03730
>Glyma13g03730.1   sequence type=CDS   gene model=Glyma13g03730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGCTTCTTCCCTCAGAATTTGATTGCCGGTATTAGAACCCCACTATTCATCAGAGATATGAACAGACGACTGAGAATGGCTACTTGTCCATTTCTCAAGAACATTGTAATTGTTTTCATAAAAAATGCTATAATAATCCAAAAACAGGAGGAAGTCTTTTCTTTTTTGTCCAAGGGCAGGAGATTTTATAGATTCAGGAATCAAATGCTGAATGCTATTAAAGGCTTCTCAAGATCACCTCAAAATGGATTGTTCATAAATTCATGTTTTGCTCACTGCCAATCTGAGAGGCAGGATACATGGTTTGTTGACAATTCTCCTGTCATTGGGAACAAGGTGGTGGGTGCTGTTGAATTGGGTTTGGGAAAGAGTGTGTGTTAG
Predicted protein sequences of Glyma13g03730
>Glyma13g03730.1   sequence type=predicted peptide   gene model=Glyma13g03730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CFFPQNLIAGIRTPLFIRDMNRRLRMATCPFLKNIVIVFIKNAIIIQKQEEVFSFLSKGRRFYRFRNQMLNAIKGFSRSPQNGLFINSCFAHCQSERQDTWFVDNSPVIGNKVVGAVELGLGKSVC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo