Glyma13g03720 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g03720

Feature Type:	gene_model
Chromosome:	Gm13
Start:	3756372
stop:	3756623
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g03720

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38400	AT	Annotation by Michelle Graham. TAIR10: alanine:glyoxylate aminotransferase 3 \| chr2:16083779-16086115 FORWARD LENGTH=493	SoyBase	E_val: 2.00E-26	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0008453	GO-mf	Annotation by Michelle Graham. GO Molecular Function: alanine-glyoxylate transaminase activity	SoyBase	N/A	ISS
GO:0008483	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transaminase activity	SoyBase	N/A	ISS
GO:0030170	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding	SoyBase	N/A	ISS
PTHR11986	Panther	AMINOTRANSFERASE CLASS III	JGI		ISS
PTHR11986:SF23	Panther	AMINOTRANSFERASE	JGI		ISS
UniRef100_B0M1A8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal aminotransferase (Fragment) n=1 Tax=Glycine max RepID=B0M1A8_SOYBN	SoyBase	E_val: 4.00E-25	ISS
UniRef100_UPI000233EA6D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EA6D related cluster n=1 Tax=unknown RepID=UPI000233EA6D	SoyBase	E_val: 1.00E-27	ISS

Expression Patterns of Glyma13g03720

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g03720 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g03720

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g03720

Limit To All Plant Sequences

>Glyma13g03720.1   sequence type=CDS   gene model=Glyma13g03720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTAATTGGTGATGTCAGAGGAAGAGGCCTAATGCTAGGAGTTGAACTTGTCACTGATCGTGAACTTAAAACTCCAGCAAAAAATGAAACATTGCATGTAATGGACCAAATGAAAGAACTAGGAGTACTTATTGGTAAGGGTGGTTACTATGGAAAT

Predicted protein sequences of Glyma13g03720

Limit To All Plant Sequences

>Glyma13g03720.1   sequence type=predicted peptide   gene model=Glyma13g03720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VIGDVRGRGLMLGVELVTDRELKTPAKNETLHVMDQMKELGVLIGKGGYYGN

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain