SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g03522): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g03522): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g03522

Feature Type:gene_model
Chromosome:Gm13
Start:3526428
stop:3529437
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G21270AT Annotation by Michelle Graham. TAIR10: wall-associated kinase 2 | chr1:7444997-7447345 FORWARD LENGTH=732 SoyBaseE_val: 3.00E-55ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0009311GO-bp Annotation by Michelle Graham. GO Biological Process: oligosaccharide metabolic process SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009992GO-bp Annotation by Michelle Graham. GO Biological Process: cellular water homeostasis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF444Panther SUBFAMILY NOT NAMED JGI ISS
PF07645PFAM Calcium-binding EGF domain JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_B9S2R0UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9S2R0_RICCO SoyBaseE_val: 3.00E-60ISS
UniRef100_I1LW91UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LW91_SOYBN SoyBaseE_val: 9.00E-129ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g03522 not represented in the dataset

Glyma13g03522 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g03522.1   sequence type=CDS   gene model=Glyma13g03522   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATAGGGTGTTGTGAAGTGGATATTCCTCCCAACATGAAGAACATCAGCATAGAAGCATATAGATTCGATTTGTCTTCCAATTACTTCCAAACTTGTGGTCATTCCTTTGTTCCCAAACGTGGCTCCTACAACTTTGATATAAGTCATTTGGAGAAGCCGTTTAACACCATCCCTATGGTTGTTGATTGGAGTGTTAGAGATGACCTGGGATGTGAGGCTTTTAGGAAACGGTTTCGAAAAAGTGCATGCATGGACAATAGCTATTGTCATGACATTGAGATTAGTTATGATGGAAACCTTTATCATCCCAATGGTTATCTAGATATTGATGAATATATTGATGAATGTAAGACAAAAAGTCATACGTGCATATCTGAGAATCATTGTCGCAACACCGATGGGTCTTATGAATGCTTTTGTCCTCCTGGGCAAGTTGGAAATGGAAAATTCGACAAAGTATGCAGGCCAATCCAGCGGAAAAATATTCTAACCAATTTTAATATTGGAAATTCATTAAACAAAGAGAACAGTTCTTTCGGCAAAATGTTGCAACAACGACTCACTACAGAACCCCCCCCCCCCCCCCCCCCCACACCCCTCCCCCCCCCCCACCCCATTGCACAAATTTTTACATCAGAAGAGCTAAAGAAGCCCACCAATAACTATGATGAGAGGTTAATCATTGACAACGGAGGTTTTGGTACGGTTTTCAAAGGAGTCCTTCCAAATAACAAGGTTGTGGCTATCAAAAAGTCCAAAGTAGTGGACAAAAGCCAAGTTGAGCAATTCATTAATGAGGTGGTTATCGTGTCCCAAATCAACCATAGGAGTGTGGTAAAACTCATAGGTTGTTGTTTAGACACTGAAGTCCCATTATTGGTCAATGAGTTTGTTAACAATGGTACCCTTTTCCATCATTTGCACAATGAAAATAAGGCAAGTTGTTATGAATGA

>Glyma13g03522.1   sequence type=predicted peptide   gene model=Glyma13g03522   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IGCCEVDIPPNMKNISIEAYRFDLSSNYFQTCGHSFVPKRGSYNFDISHLEKPFNTIPMVVDWSVRDDLGCEAFRKRFRKSACMDNSYCHDIEISYDGNLYHPNGYLDIDEYIDECKTKSHTCISENHCRNTDGSYECFCPPGQVGNGKFDKVCRPIQRKNILTNFNIGNSLNKENSSFGKMLQQRLTTEPPPPPPPTPLPPPHPIAQIFTSEELKKPTNNYDERLIIDNGGFGTVFKGVLPNNKVVAIKKSKVVDKSQVEQFINEVVIVSQINHRSVVKLIGCCLDTEVPLLVNEFVNNGTLFHHLHNENKASCYE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo