|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G44414 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; Has 29 Blast hits to 29 proteins in 12 species: Archae - 0; Bacteria - 4; Metazoa - 0; Fungi - 0; Plants - 25; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:16847781-16848086 FORWARD LENGTH=101 | SoyBase | E_val: 4.00E-15 | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
| GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
| GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_I1LW86 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LW86_SOYBN | SoyBase | E_val: 2.00E-45 | ISS |
|
Glyma13g03440 not represented in the dataset |
Glyma13g03440 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g03440.1 sequence type=CDS gene model=Glyma13g03440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTCTTTTTCTTCGTGGGAGGGTTACCGCAAGAGTTGCGGCAGGTGCTGAAATCTGGTGTGGGCAAGTGCACGTGCTGCGCCAACAACCGCGTCGATCTCGTCAACTACGACAAGGTTCTCAAACTCTTCTTCGTTCCTGCCGCCCGGAACCGCCGCCGATTCGGCGTCGGCGAAGGTTCCCGGCGCCTTGCGCTGCCGTTTATGCGACCGCGCGGTGGAGGCTGA
>Glyma13g03440.1 sequence type=predicted peptide gene model=Glyma13g03440 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFFFFVGGLPQELRQVLKSGVGKCTCCANNRVDLVNYDKVLKLFFVPAARNRRRFGVGEGSRRLALPFMRPRGGG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||