Glyma13g03410 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g03410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g03410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g03410

Feature Type:	gene_model
Chromosome:	Gm13
Start:	3398041
stop:	3399703
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g03410

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G08670	AT	Annotation by Michelle Graham. TAIR10: ATP synthase alpha/beta family protein \| chr5:2818395-2821149 REVERSE LENGTH=556	SoyBase	E_val: 3.00E-78	ISS
GO:0006200	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP catabolic process	SoyBase	N/A	ISS
GO:0006754	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP biosynthetic process	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0015986	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport	SoyBase	N/A	ISS
GO:0015991	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport	SoyBase	N/A	ISS
GO:0046034	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP metabolic process	SoyBase	N/A	ISS
GO:0000275	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex, catalytic core F(1)	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0005753	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016469	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex	SoyBase	N/A	ISS
GO:0033178	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, catalytic domain	SoyBase	N/A	ISS
GO:0045261	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, catalytic core F(1)	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0008553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
GO:0046933	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism	SoyBase	N/A	ISS
GO:0046961	GO-mf	Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism	SoyBase	N/A	ISS
GO:0050897	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding	SoyBase	N/A	ISS
PTHR15184	Panther	ATP SYNTHASE	JGI		ISS
PTHR15184:SF8	Panther	gb def: invasion protein [shigella flexneri]	JGI		ISS
PF00006	PFAM	ATP synthase alpha/beta family, nucleotide-binding domain	JGI		ISS
PF02874	PFAM	ATP synthase alpha/beta family, beta-barrel domain	JGI		ISS
UniRef100_I1LEP2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase subunit beta n=1 Tax=Glycine max RepID=I1LEP2_SOYBN	SoyBase	E_val: 4.00E-95	ISS
UniRef100_UPI000233DE40	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DE40 related cluster n=1 Tax=unknown RepID=UPI000233DE40	SoyBase	E_val: 3.00E-99	ISS

Expression Patterns of Glyma13g03410

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g03410 not represented in the dataset	Glyma13g03410 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g03410 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g03410

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g03410

Limit To All Plant Sequences

>Glyma13g03410.1   sequence type=CDS   gene model=Glyma13g03410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACCGATGAATTCATCGGGAAGGGTGCGATAGGGCAGGTCTGCCAGGTCATTGGTGTCGTCGTCGATGTCAAATTCGACGAGGGTTTGCCTCCGATCATGACCGCGCTGGAGGTTCTGGATCACTCGTTGAGGCTTGTGTTGGAGGTGGCGCAACATTTGGGTGAAGGCGTTCGCGTTCTCAACACTGGCTCCCCTATTACTTTCAACCTTGCATTTGGTGAATTCTACTTTGCTATTGTGTTTGGATTTGATTTGATTTTCGTATCCGAGTTGTTGTTTCATTATACTGAGCATTATTTGCCCATTCATAGAGAAGCTCCTGCTTTTGTTGAGCAAGAAACTGCACAACAGATTCTTGTTATTGGAATCAAGGTTGTTGACCTGCTTGCACCATATCAAAGAGGAGGAAAGATTGGGTTGTTTGGTGGTGCTGGTGTAGGAAAAATTGTGCTTATTATGGAACTTATTAACAATGTTGCAAAAGCTCATGGTATAGTGGTGTCATTAAGCTTGATGCAGACTGAAAGCAAGTGTGCTCTTGTGTATGGTCAAATGAATGAGCCCCCTGGTGCTCATGCCCGTGTTGGTCTTACTGGGCTTACTGTGGGTGAACACTTC

Predicted protein sequences of Glyma13g03410

Limit To All Plant Sequences

>Glyma13g03410.1   sequence type=predicted peptide   gene model=Glyma13g03410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TDEFIGKGAIGQVCQVIGVVVDVKFDEGLPPIMTALEVLDHSLRLVLEVAQHLGEGVRVLNTGSPITFNLAFGEFYFAIVFGFDLIFVSELLFHYTEHYLPIHREAPAFVEQETAQQILVIGIKVVDLLAPYQRGGKIGLFGGAGVGKIVLIMELINNVAKAHGIVVSLSLMQTESKCALVYGQMNEPPGAHARVGLTGLTVGEHF

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain