Glyma13g02790 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g02790

Feature Type:	gene_model
Chromosome:	Gm13
Start:	2757296
stop:	2757849
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g02790

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G08240	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). \| chr4:5194713-5195756 FORWARD LENGTH=136	SoyBase	E_val: 4.00E-17	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1LW53	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LW53_SOYBN	SoyBase	E_val: 2.00E-92	ISS

Expression Patterns of Glyma13g02790

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g02790

Paralog	Evidence	Comments
Glyma14g33130	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g02790 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g02790

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g02790

Limit To All Plant Sequences

>Glyma13g02790.1   sequence type=CDS   gene model=Glyma13g02790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAAAGAGAGGAATCAGAGGACCCCTTCTATGCATTGGAGATCTCCTAAACGACATTGGAGAAGAAGAAGAAGAAGGACGAGGACACTCTCTCCTTCGTGAAGCATCTCCCTCTCCCTCTTCTTCCCTTCTCAACAACCTCACCAAACTCTTCCAGGAACACTACGACCACTTAAATTCTACACTCTCCGGCACCGACCACTCCTGGACTTCTCTCACCCTCAAGGTCATGTTATGTGTCCCAATCTCTTACCATAAACCAAATCCAATTTTATTAAACGATGCTATCTATCATTGTTGTTGTTGTTGCATCACTTTAAGAATTTTACAATGTGAACCTATCAGAAATTATGGTAGCCATGCATTTATTGTAATAGAAAATAGTGTATGTATCGAAATGTAA

Predicted protein sequences of Glyma13g02790

Limit To All Plant Sequences

>Glyma13g02790.1   sequence type=predicted peptide   gene model=Glyma13g02790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKRGIRGPLLCIGDLLNDIGEEEEEGRGHSLLREASPSPSSSLLNNLTKLFQEHYDHLNSTLSGTDHSWTSLTLKVMLCVPISYHKPNPILLNDAIYHCCCCCITLRILQCEPIRNYGSHAFIVIENSVCIEM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain