SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g02740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g02740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g02740

Feature Type:gene_model
Chromosome:Gm13
Start:2707720
stop:2712881
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08640AT Annotation by Michelle Graham. TAIR10: flavonol synthase 1 | chr5:2804009-2805175 FORWARD LENGTH=336 SoyBaseE_val: 8.00E-150ISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
GO:0045431GO-mf Annotation by Michelle Graham. GO Molecular Function: flavonol synthase activity SoyBaseN/AISS
KOG0143 KOG Iron/ascorbate family oxidoreductases JGI ISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
PTHR10209:SF55Panther OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI JGI ISS
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI ISS
UniRef100_Q0EDG6UniRef Annotation by Michelle Graham. Best UniRef hit: Flavonol synthase n=1 Tax=Glycine max RepID=Q0EDG6_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q0EDG6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flavonol synthase n=1 Tax=Glycine max RepID=Q0EDG6_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g02740 not represented in the dataset

Glyma13g02740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma14g33227 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g082300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g02740.1   sequence type=CDS   gene model=Glyma13g02740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGTGCTAAGGGTGCAAACCATAGCTTCCAAATCCAAAGATGCTGCCATCCCAGCCATGTTTGTTAGGGCAGAGACAGAGCAACCAGGCATCACAACCGTTCAAGGGGTGAACCTTGAGGTGCCAATTATTGATTTTAGTGACCCAGATGAAGGGAAAGTGGTGCATGAGATTTTGGAGGCAAGTAGGGACTGGGGCATGTTCCAAATTGTGAACCATGACATACCTAGTGATGTTATAAGAAAGTTGCAAAGTGTTGGGAAAATGTTCTTTGAGTTGCCACAAGAGGAAAAAGAGTTGATTGCTAAGCCTGCTGGGTCTGATTCTATTGAAGGGTATGGCACAAAGCTTCAGAAAGAGGTGAATGGCAAGAAAGGGTGGGTGGATCATTTGTTCCACATTGTGTGGCCTCCTTCCTCCATCAACTACAGTTTCTGGCCCCAAAACCCCCCTTCTTACAGGGAAGTTAATGAGGAATATTGCAAGCACCTAAGAGGAGTGGTAGACAAATTGTTCAAAAGTATGTCGGTAGGGTTGGGGCTTGAAGAGAATGAGCTAAAGGAGGGTGCAAATGAAGATGACATGCATTATCTTTTAAAAATCAATTATTACCCACCTTGTCCATGTCCTGATCTGGTCTTGGGTGTGCCACCACACACAGACATGTCCTACCTCACAATTCTGGTGCCTAACGAGGTGCAGGGCCTTCAAGCATGTAGGGATGGCCATTGGTACGATGTTAAGTATGTCCCCAATGCCCTCGTTATTCACATTGGCGACCAAATGGAGATACTGAGCAATGGAAAATATAAGGCAGTTTTTCACAGAACAACAGTGAACAAAGATGAGACAAGAATGTCGTGGCCCGTGTTCATAGAACCCAAAAAGGAACAAGAAGTTGGTCCTCACCCAAAGTTGGTTAACCAAGACAATCCACCAAAATACAAAACCAAGAAATACAAGGATTATGCTTATTGTAAGCTCAATAAGATCCCTCAATGA

>Glyma13g02740.1   sequence type=predicted peptide   gene model=Glyma13g02740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVLRVQTIASKSKDAAIPAMFVRAETEQPGITTVQGVNLEVPIIDFSDPDEGKVVHEILEASRDWGMFQIVNHDIPSDVIRKLQSVGKMFFELPQEEKELIAKPAGSDSIEGYGTKLQKEVNGKKGWVDHLFHIVWPPSSINYSFWPQNPPSYREVNEEYCKHLRGVVDKLFKSMSVGLGLEENELKEGANEDDMHYLLKINYYPPCPCPDLVLGVPPHTDMSYLTILVPNEVQGLQACRDGHWYDVKYVPNALVIHIGDQMEILSNGKYKAVFHRTTVNKDETRMSWPVFIEPKKEQEVGPHPKLVNQDNPPKYKTKKYKDYAYCKLNKIPQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo