Glyma13g02461 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g02461): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g02461): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g02461

Feature Type:	gene_model
Chromosome:	Gm13
Start:	2339658
stop:	2340293
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g02461

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G29570	AT	Annotation by Michelle Graham. TAIR10: proliferating cell nuclear antigen 2 \| chr2:12650139-12651598 REVERSE LENGTH=264	SoyBase	E_val: 1.00E-52	ISS
GO:0006260	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication	SoyBase	N/A	ISS
GO:0006261	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication	SoyBase	N/A	ISS
GO:0006275	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication	SoyBase	N/A	ISS
GO:0006306	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA methylation	SoyBase	N/A	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0042276	GO-bp	Annotation by Michelle Graham. GO Biological Process: error-prone translesion synthesis	SoyBase	N/A	ISS
GO:0051567	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0043626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: PCNA complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0030337	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA polymerase processivity factor activity	SoyBase	N/A	ISS
PTHR11352	Panther	PROLIFERATING CELL NUCLEAR ANTIGEN	JGI		ISS
PF02747	PFAM	Proliferating cell nuclear antigen, C-terminal domain	JGI		ISS
UniRef100_P22177	UniRef	Annotation by Michelle Graham. Best UniRef hit: Proliferating cell nuclear antigen (Fragment) n=2 Tax=Glycine max RepID=PCNA_SOYBN	SoyBase	E_val: 2.00E-61	ISS
UniRef100_P22177	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Proliferating cell nuclear antigen (Fragment) n=2 Tax=Glycine max RepID=PCNA_SOYBN	SoyBase	E_val: 2.00E-61	ISS

Expression Patterns of Glyma13g02461

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g02461 not represented in the dataset	Glyma13g02461 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g02461 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g084200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g02461

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g02461

Limit To All Plant Sequences

>Glyma13g02461.1   sequence type=CDS   gene model=Glyma13g02461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAAGATAAGATTTCTGATTTTGAGATGAAGCTGATGGACATCGACAATGAGTACCTTGGGATTCTAGAGGTGTATCATGTTATGATTTGCAAGGATCTCAATAGTATTGATGACACTATTGTCATTTTGATTACTAAGGAGGGTGTAAAGTTTTCCACCAAAGGAGACATTGGAACTACCAATATAGTTTGCAAGCAGAATACTTCTATGGACAAGCCTGAAGAAGCTTCTATCATTGAGATGAATGAGCCATTGTCCAACATAGTTATCATTAGTTTATCAAATGAGCTATCAGTTGTAGTTGAGTACAAGATTGTTAAGATGGGTTATGTGTGCTTCTACTTGGCTCCTAAGATAGAAGAGGGTGAAGAAGATACAAAACCTCAAGTTTAA

Predicted protein sequences of Glyma13g02461

Limit To All Plant Sequences

>Glyma13g02461.1   sequence type=predicted peptide   gene model=Glyma13g02461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QDKISDFEMKLMDIDNEYLGILEVYHVMICKDLNSIDDTIVILITKEGVKFSTKGDIGTTNIVCKQNTSMDKPEEASIIEMNEPLSNIVIISLSNELSVVVEYKIVKMGYVCFYLAPKIEEGEEDTKPQV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain