Glyma13g02146 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g02146): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g02146): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g02146

Feature Type:	gene_model
Chromosome:	Gm13
Start:	1989462
stop:	1990679
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g02146

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G64290	AT	Annotation by Michelle Graham. TAIR10: dicarboxylate transport 2.1 \| chr5:25714495-25716642 REVERSE LENGTH=563	SoyBase	E_val: 7.00E-116	ISS
GO:0009624	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nematode	SoyBase	N/A	ISS
GO:0015729	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxaloacetate transport	SoyBase	N/A	ISS
GO:0015743	GO-bp	Annotation by Michelle Graham. GO Biological Process: malate transport	SoyBase	N/A	ISS
GO:0015813	GO-bp	Annotation by Michelle Graham. GO Biological Process: L-glutamate transport	SoyBase	N/A	ISS
GO:0019676	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonia assimilation cycle	SoyBase	N/A	ISS
GO:0071423	GO-bp	Annotation by Michelle Graham. GO Biological Process: malate transmembrane transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005313	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-glutamate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015131	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxaloacetate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015140	GO-mf	Annotation by Michelle Graham. GO Molecular Function: malate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015367	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxoglutarate:malate antiporter activity	SoyBase	N/A	ISS
PTHR10283	Panther	CATION TRANSPORTER RELATED	JGI		ISS
PTHR10283:SF13	Panther	gb def: conserved hypothetical protein [thermotoga maritima]	JGI		ISS
PF00939	PFAM	Sodium:sulfate symporter transmembrane region	JGI		ISS
UniRef100_G7IPL2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 2-oxoglutarate/malate translocator n=1 Tax=Medicago truncatula RepID=G7IPL2_MEDTR	SoyBase	E_val: 3.00E-126	ISS
UniRef100_UPI000233BC54	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233BC54 related cluster n=1 Tax=unknown RepID=UPI000233BC54	SoyBase	E_val: 3.00E-142	ISS

Expression Patterns of Glyma13g02146

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g02146 not represented in the dataset	Glyma13g02146 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g02146 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g086700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g02146

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g02146

Limit To All Plant Sequences

>Glyma13g02146.1   sequence type=CDS   gene model=Glyma13g02146   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTCAAAATCTACTGTCTCAAATTAGCAGAGGAGCTTGGGGTGATAGTTCCTAACCCATGGGTTACTTGCTTTAAGGCGGCTAGTTTACCTGCCATTGTTTGTCTTCTTATGCCATTGATTTTGTACAAGCTCTATCCCCCTGAAATCAAAGACACACCAGAGGCTCCTGCCCTGGCTGCCAAGAAACTGGAAAGTATGGGCCTTGTCATTAAAAACGAATGGATTATGGTCGGCACAATGCTCCTTGCAGTGTCTTTATGGATCTTTGGCATAGCAAGTGCTGTAGCTGCAATGATTGGTTTATCAATACTCCTCCTATTAGGAGTCCTTGACTGGAATAACTGTTGGAATGAAAAATCAGCATGGGATACCTTAGCTTGGTTTGCCATTTTGGTAGGTATGGCAAGCCAGTTGACAAACCTTGGTTATGTGAGCTGGATGTCTGATTGTGTGGCCAACAACCTTCGGTCATTCTCTTTGAGCTGGCCGGCTTCAGTAGCTGTTCTTCAGGCAGCTTATTTCTTCATCCACTACCTTTTTGCAAGTCAGACTGGACACGTGGGGGCTTTATACTCCGCAGTTCTTGCCATGCATAAGGCAGGTGGTGTTCCTGGTATTTTGGCAGCCCTTGCTTTAGGTTATAATACAAATCTTTTTGGTGCAATAACACTATAG

Predicted protein sequences of Glyma13g02146

Limit To All Plant Sequences

>Glyma13g02146.1   sequence type=predicted peptide   gene model=Glyma13g02146   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LKIYCLKLAEELGVIVPNPWVTCFKAASLPAIVCLLMPLILYKLYPPEIKDTPEAPALAAKKLESMGLVIKNEWIMVGTMLLAVSLWIFGIASAVAAMIGLSILLLLGVLDWNNCWNEKSAWDTLAWFAILVGMASQLTNLGYVSWMSDCVANNLRSFSLSWPASVAVLQAAYFFIHYLFASQTGHVGALYSAVLAMHKAGGVPGILAALALGYNTNLFGAITL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain