Report for Sequence Feature Glyma13g01590
Feature Type: gene_model
Chromosome: Gm13
Start: 1294642
stop: 1298181
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g01590
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G57815 AT
Annotation by Michelle Graham. TAIR10: Cytochrome c oxidase, subunit Vib family protein | chr5:23426753-23427637 FORWARD LENGTH=78
SoyBase E_val: 6.00E-47 ISS
GO:0006661 GO-bp
Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0004129 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cytochrome-c oxidase activity
SoyBase N/A ISS
PTHR11387 Panther
CYTOCHROME C OXIDASE POLYPEPTIDE VIB
JGI ISS
PTHR11387:SF2 Panther
CYTOCHROME C OXIDASE POLYPEPTIDE VIB
JGI ISS
PF02297 PFAM
Cytochrome oxidase c subunit VIb
JGI ISS
UniRef100_B6STB2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c oxidase polypeptide VIb n=1 Tax=Zea mays RepID=B6STB2_MAIZE
SoyBase E_val: 4.00E-45 ISS
UniRef100_I1LVX2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LVX2_SOYBN
SoyBase E_val: 2.00E-50 ISS
Expression Patterns of Glyma13g01590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma13g01590
Paralog Evidence Comments
Glyma17g07710 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g01590 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g090900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g01590
Coding sequences of Glyma13g01590
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g01590.1 sequence type=CDS gene model=Glyma13g01590 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGGAGATTGAACTGAAAACTGCACCTGCTGATTTTCGTTTTCCTACAACAAATCAAACCAGACATTGTTTCACTCGCTACATAGAGTTTCACAGATGCTTGGCAGCAAAGGGTGAAAACTCTGGTGAATGTGAGAGATTTGCTAAATATTACCGCTCCCTTTGCCCGGGTGAATGGGTTGAAAGGTGGAATGAACAGAGGGAGAGTGGGACTTTTCCAGGACCTCTTTGA
Predicted protein sequences of Glyma13g01590
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g01590.1 sequence type=predicted peptide gene model=Glyma13g01590 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEWVERWNEQRESGTFPGPL*