Glyma13g01451 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g01451): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g01451): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g01451

Feature Type:	gene_model
Chromosome:	Gm13
Start:	1165375
stop:	1166907
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g01451

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G33300	AT	Annotation by Michelle Graham. TAIR10: ADR1-like 1 \| chr4:16051162-16054005 REVERSE LENGTH=816	SoyBase	E_val: 2.00E-51	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009963	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0043531	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ADP binding	SoyBase	N/A	ISS
PF00931	PFAM	NB-ARC domain	JGI		ISS
UniRef100_G7I4I5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nbs-lrr resistance protein n=1 Tax=Medicago truncatula RepID=G7I4I5_MEDTR	SoyBase	E_val: 5.00E-86	ISS
UniRef100_I1M8I5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M8I5_SOYBN	SoyBase	E_val: 8.00E-106	ISS

Expression Patterns of Glyma13g01451

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g01451 not represented in the dataset	Glyma13g01451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g01451 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g092200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g01451

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g01451

Limit To All Plant Sequences

>Glyma13g01451.1   sequence type=CDS   gene model=Glyma13g01451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTAGAATACCAGGTTGCAAGTTTCTTGTGGTGTCAAGGCCTAAATTCCAAACGGTGTTGAGTTATGAAATGGAATTGCTGATTGAAGAGGATGCCCTGTCTTTGTTCTGTCACCATGCTTTTGGACAGAAATCAATTCCTTTAGCTGCTAATGAGAATTCGGTCAAGCAGGTTGTGACTGAATGTGGAAGGCTTCCCTTGGCTCTTAAGGTGATTGGAGCTTCTTTGCGAGATCAAACTGAGATGTTTTGGTTGAGTGTTAAAAATAGGCTATCTCAGGGACAAAGTATTGGGGAATCCCATGAAATCAATCTGATTGACAGAATGGCAATTAGTATCAATTACCTTCCAGAGAAGATCAAGGAGTGCTACTTAGACCTGTGCTGTTTTCCTAAGGATAAGAAAATCCCTCTGGATGTTCTCATCAATATGTGGGTGGAAATCCATGGTATTCCTGAAACAGAAGCTTATGCCATTGTGATTGAGCTCTCCAACAAAAAATTTCCTCACCTTATTGAAAGAGGCTCGTGCTGCAGGCACGTATAG

Predicted protein sequences of Glyma13g01451

Limit To All Plant Sequences

>Glyma13g01451.1   sequence type=predicted peptide   gene model=Glyma13g01451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCRIPGCKFLVVSRPKFQTVLSYEMELLIEEDALSLFCHHAFGQKSIPLAANENSVKQVVTECGRLPLALKVIGASLRDQTEMFWLSVKNRLSQGQSIGESHEINLIDRMAISINYLPEKIKECYLDLCCFPKDKKIPLDVLINMWVEIHGIPETEAYAIVIELSNKKFPHLIERGSCCRHV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain