Glyma13g01320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g01320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g01320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g01320

Feature Type:	gene_model
Chromosome:	Gm13
Start:	1013055
stop:	1014978
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g01320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G30330	AT	Annotation by Michelle Graham. TAIR10: Small nuclear ribonucleoprotein family protein \| chr4:14836773-14837919 REVERSE LENGTH=88	SoyBase	E_val: 2.00E-54	ISS
GO:0016925	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein sumoylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005732	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1774	KOG	Small nuclear ribonucleoprotein E	JGI		ISS
PTHR11193	Panther	SNRNP SM FAMILY MEMBER	JGI		ISS
PF01423	PFAM	LSM domain	JGI		ISS
UniRef100_C6SYH7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYH7_SOYBN	SoyBase	E_val: 6.00E-56	ISS
UniRef100_G7IMA2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Small nuclear ribonucleoprotein E n=1 Tax=Medicago truncatula RepID=G7IMA2_MEDTR	SoyBase	E_val: 3.00E-55	ISS

Expression Patterns of Glyma13g01320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g01320 not represented in the dataset	Glyma13g01320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g01320

Paralog	Evidence	Comments
Glyma17g07460	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g01320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g093400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g01320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g01320

Limit To All Plant Sequences

>Glyma13g01320.1   sequence type=CDS   gene model=Glyma13g01320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAGCACCAAAGTTCAGAGGGTTATGACTCAGCCCATTAACTTGATTTTCAGGTTTCTTCAGAGCAAAGCACGCATTCAGATTTGGCTATTTGAGCAAAAGGATTTGAGGATTGAAGGCCGAATCATTGGTTTTGATGAATACATGAATTTGGTTCTTGATGATGCTGAAGAAGTGAACATCAAGAAGAAGAGCAGAAAAACATTAGGGAGGATCCTTCTTAAAGGAGATAACATAACTTTAATGATGAACACGGGGAAATGA

Predicted protein sequences of Glyma13g01320

Limit To All Plant Sequences

>Glyma13g01320.1   sequence type=predicted peptide   gene model=Glyma13g01320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTKVQRVMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVNIKKKSRKTLGRILLKGDNITLMMNTGK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain