SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g01260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g01260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g01260

Feature Type:gene_model
Chromosome:Gm13
Start:932383
stop:933493
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57655AT Annotation by Michelle Graham. TAIR10: xylose isomerase family protein | chr5:23347030-23348720 FORWARD LENGTH=287 SoyBaseE_val: 2.00E-62ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009045GO-mf Annotation by Michelle Graham. GO Molecular Function: xylose isomerase activity SoyBaseN/AISS
UniRef100_I1MSU1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xylose isomerase n=2 Tax=Glycine max RepID=I1MSU1_SOYBN SoyBaseE_val: 2.00E-69ISS
UniRef100_UPI000233BAF4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BAF4 related cluster n=1 Tax=unknown RepID=UPI000233BAF4 SoyBaseE_val: 4.00E-94ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g01260 not represented in the dataset

Glyma13g01260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g07380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g01260.1   sequence type=CDS   gene model=Glyma13g01260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTGGTGCTCCTCAAACTTGCGCTGCTAACGATGCGGATAAATGCGGCGATTCAGATGAATGGGAAGGGGAGTTTTTCCCTGGCATTCCCAAAATTAAATATGAGGGTCCGTCAAGTAAGAGTCCACTTTCATTTAAATGGTATAATGCAGAGGAGGAAATTCTTGGGAAGAAAATGAAGCGTTGCATTTTGGCATACAAACAGGTGCTGAGTGCTGACCCATTTGGCGCACCTACCAAATATTGGCCATGGGAAGATGGTACCAATTCATTAAAAATGGCTAAAAGACGAATGAGAGCTAACTTTGAGTTCATAAGCAAACTCGGTGTCGATTTTTGGTGCTTCCACGACAGGGATATAGCCCCTGATGGAAAAACTCTTGAGGCGAGTCAATATTTAAGTTTCTTCACTTATTTGCAATTCTTAGACAGGATCAAA

>Glyma13g01260.1   sequence type=predicted peptide   gene model=Glyma13g01260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IGAPQTCAANDADKCGDSDEWEGEFFPGIPKIKYEGPSSKSPLSFKWYNAEEEILGKKMKRCILAYKQVLSADPFGAPTKYWPWEDGTNSLKMAKRRMRANFEFISKLGVDFWCFHDRDIAPDGKTLEASQYLSFFTYLQFLDRIK







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo