SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g01140

Feature Type:gene_model
Chromosome:Gm13
Start:857863
stop:859396
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g01140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G25810AT Annotation by Michelle Graham. TAIR10: xyloglucan endotransglycosylase 6 | chr4:13128694-13129715 FORWARD LENGTH=286 SoyBaseE_val: 1.00E-156ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006073GO-bp Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0016762GO-mf Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity SoyBaseN/AISS
GO:0016798GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds SoyBaseN/AISS
PTHR10963Panther SECRETED GLUCOSIDASE-RELATED JGI ISS
PTHR10963:SF14Panther BETA-GLUCANASE JGI ISS
PF00722PFAM Glycosyl hydrolases family 16 JGI ISS
PF06955PFAM Xyloglucan endo-transglycosylase (XET) C-terminus JGI ISS
UniRef100_C6THE7UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6THE7_SOYBN SoyBaseE_val: 0ISS
UniRef100_G7JD12UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglucosylase/hydrolase n=1 Tax=Medicago truncatula RepID=G7JD12_MEDTR SoyBaseE_val: 2.00E-170ISS

Expression Patterns of Glyma13g01140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g01140
ParalogEvidenceComments
Glyma17g07250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g01140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g095000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g01140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g01140
>Glyma13g01140.1   sequence type=CDS   gene model=Glyma13g01140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTTCCTTCTCTCCAAGCCTATCATCACTTGTGCCTCTGCTTGTGAGCCTTTTCATTGTGGTTTGTGCTGCCGGTAACTTCAACCAAGACTTTCAGATTACGTGGGGAGATGGTCGTGCAAAAATACTCAACAACGCCAATCTTCTCACTCTCTCCCTTGACAAGGCCTCTGGCTCTGGCTTCCAATCCAAGAACGAATACTTATTTGGCAAGATTGACATGCAGCTCAAGCTCGTTCCTGGAAACTCTGCTGGCACTGTCACCGCTTATTATCTATCTTCAAAGGGATCAACATGGGATGAGATTGACTTCGAGTTCTTGGGGAATCTCAGTGGTGACCCTTACATTCTGCATACTAATGTGTTCAGCCAGGGCAAGGGCAACAGAGAGCAGCAATTCTATCTCTGGTTTGACCCAACTGCAGATTTCCACACTTATTCAATTCTTTGGAATCCCCAACGCATTGTTTTTTCTGTGGATGGCACCCCTATAAGAGAATTCAAGAATTTAGAATCAATTGGAGTTCCTTTTCCGAAGAGGCAACCGATGAGGATATACTCAAGCCTATGGAACGCTGATGATTGGGCCACAAGGGGTGGACGCATCAAAACCGATTGGTCCAAAGCTCCTTTCACTGCATCCTACAGAAACTTCAACGCTAACGCTTGTGTTTGGAACAGAGGAAAATCCACATGCAAATCAAATTCACCATCCTCTAATGCATGGCTATCACAAGAGCTGGATTCCACTGCTCAGCAAAGGCTGAGCTGGGTGCAGAAGAATTACATGATTTACAATTATTGCTCCGACAAAAACAGATTTGCTCAAGGCCTTCCACTCGAATGCACACATTCGTAG
Predicted protein sequences of Glyma13g01140
>Glyma13g01140.1   sequence type=predicted peptide   gene model=Glyma13g01140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSFSPSLSSLVPLLVSLFIVVCAAGNFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWATRGGRIKTDWSKAPFTASYRNFNANACVWNRGKSTCKSNSPSSNAWLSQELDSTAQQRLSWVQKNYMIYNYCSDKNRFAQGLPLECTHS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo