Report for Sequence Feature Glyma13g01090
Feature Type: gene_model
Chromosome: Gm13
Start: 819172
stop: 820405
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g01090
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G57520 AT
Annotation by Michelle Graham. TAIR10: zinc finger protein 2 | chr5:23296019-23296471 FORWARD LENGTH=150
SoyBase E_val: 1.00E-26 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003676 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
PTHR10042 Panther
EARLY GROWTH RESPONSE PROTEIN
JGI ISS
PTHR10042:SF14 Panther
ZFP4 (ZINC FINGER PROTEIN 4), NUCLEIC ACID BINDING
JGI ISS
UniRef100_G7JVH8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein n=1 Tax=Medicago truncatula RepID=G7JVH8_MEDTR
SoyBase E_val: 2.00E-49 ISS
UniRef100_I1LVS6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1LVS6_SOYBN
SoyBase E_val: 3.00E-90 ISS
Expression Patterns of Glyma13g01090
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma13g01090
Paralog Evidence Comments
Glyma17g07200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g01090 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g095500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g01090
Coding sequences of Glyma13g01090
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g01090.2 sequence type=CDS gene model=Glyma13g01090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAATTTCCATAACCCCAATTATTCTCTTCACCTACGCCAACCAGATGATGAGAACCATCTCAACCTAGATCTTCTTCTTGAGCCATCTTCTTCTTCATCATCTTCACCTTCACCTATTAGTCCCGTTGAGCCACGGATATTCTCATGCAACTATTGCCAGAGAAAGTTCTATAGCTCTCAAGCACTAGGGGGTCATCAAAATGCTCACAAGCTTGAAAGGACACTGGCCAAGAAGAGCAGGGAACTGAGTTCAAACATGCAATCTTATGGATCACCGGAGCAAAGATCAAACTTTGGTGCTTCACACCATCTTGGTCGTGCTCTTGGGGTTGTGGATAACCAAGGACAAAGTTATGCGAGGCTTGGTGGAAGAAAAGAGTTCAGTTATGGTTCCAAGGAAGGGGTAGGGGTGGCTTCTTCCTGGTCAAGGGGTTATACTTCTGAACATGTTCAGGAGGATATGGGCCAACTGGACTTGTCGTTGAGGCTTTGA
Predicted protein sequences of Glyma13g01090
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g01090.2 sequence type=predicted peptide gene model=Glyma13g01090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNFHNPNYSLHLRQPDDENHLNLDLLLEPSSSSSSSPSPISPVEPRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAKKSRELSSNMQSYGSPEQRSNFGASHHLGRALGVVDNQGQSYARLGGRKEFSYGSKEGVGVASSWSRGYTSEHVQEDMGQLDLSLRL*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
