SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g01011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g01011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g01011

Feature Type:gene_model
Chromosome:Gm13
Start:738212
stop:741929
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g01011
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18850AT Annotation by Michelle Graham. TAIR10: SET domain-containing protein | chr2:8160788-8163479 FORWARD LENGTH=536 SoyBaseE_val: 6.00E-33ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7JVG8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 3-hydroxy-3-methylglutaryl-coenzyme A reductase n=1 Tax=Medicago truncatula RepID=G7JVG8_MEDTR SoyBaseE_val: 4.00E-59ISS
UniRef100_I1MSR3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MSR3_SOYBN SoyBaseE_val: 1.00E-85ISS

Expression Patterns of Glyma13g01011
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g01011 not represented in the dataset
Glyma13g01011 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g01011
ParalogEvidenceComments
Glyma17g07110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g01011 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g096300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g01011
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g01011
>Glyma13g01011.1   sequence type=CDS   gene model=Glyma13g01011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTCTTACAGTCCCAGGAATGAGTTGGAGGCTCTCAATTCAATTGTTTGGCTCACTGACGTATCACTTTCTACTTGTACACATCTCCATACGAATATTTTGCAAGGGTTATGCCTAACAATTCTTGATTTAATTTCTGATTTTGGGGACAAAAACGGGGTGAAGGAAGTAGTTAAAAAAAACCACAGTTGTGACCAAGAAGAATGTCTGATAGAATCGGGTGAAAGCAATGGTGCAATGACACAATTAAAAATAGCTTATATTGAAGGAGCCGATCAGGGTGCAATAGCAAGGAAAGATCTAAAAGTTGGAGACGTTGCTTTGGAAATTCCTGTGTCCATTATCATTTCCGAGGAGCTTTTGCATGAAACTGATATGTACGGTGTCTTAAAAGAGATTGATGGCATATCATCTGAGACAATATTGCTATTATGGAGTATGAAAGAAAAGTATAAGTGA
Predicted protein sequences of Glyma13g01011
>Glyma13g01011.1   sequence type=predicted peptide   gene model=Glyma13g01011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESYSPRNELEALNSIVWLTDVSLSTCTHLHTNILQGLCLTILDLISDFGDKNGVKEVVKKNHSCDQEECLIESGESNGAMTQLKIAYIEGADQGAIARKDLKVGDVALEIPVSIIISEELLHETDMYGVLKEIDGISSETILLLWSMKEKYK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo