Glyma13g00910 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g00910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g00910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g00910

Feature Type:	gene_model
Chromosome:	Gm13
Start:	629039
stop:	630764
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g00910

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G38420	AT	Annotation by Michelle Graham. TAIR10: Ribulose bisphosphate carboxylase (small chain) family protein \| chr5:15381203-15381978 REVERSE LENGTH=181	SoyBase	E_val: 1.00E-59	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0010114	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to red light	SoyBase	N/A	ISS
GO:0010218	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to far red light	SoyBase	N/A	ISS
GO:0015977	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbon fixation	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009573	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ribulose bisphosphate carboxylase complex	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0016984	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ribulose-bisphosphate carboxylase activity	SoyBase	N/A	ISS
PF00101	PFAM	Ribulose bisphosphate carboxylase, small chain	JGI		ISS
UniRef100_I1LVQ6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribulose bisphosphate carboxylase small chain n=1 Tax=Glycine max RepID=I1LVQ6_SOYBN	SoyBase	E_val: 3.00E-127	ISS
UniRef100_I1LVQ6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Ribulose bisphosphate carboxylase small chain n=1 Tax=Glycine max RepID=I1LVQ6_SOYBN	SoyBase	E_val: 3.00E-127	ISS

Expression Patterns of Glyma13g00910

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g00910 not represented in the dataset	Glyma13g00910 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g00910 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g097100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g00910

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g00910

Limit To All Plant Sequences

>Glyma13g00910.1   sequence type=CDS   gene model=Glyma13g00910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGCTGCAACTTTTGCAGCTCATATTGCTGGGGCTGGCTTTGTAGGCTTGAAGTCCAACTCATCAAATCTTTGCCCCAGTACTGGATCCATAGGATGGAAAAGGAAGATTGTTTCAAATGGTTCTAAAACTTACTGCATGAAGACATGGAATCCCATCAACAATAAGAAGTTTGAAACACTGTCCTACCTGCCACCCCTTTCAGATGAATCCATTGCAAAGGAGATTGACTACATGCTCAAGAAGGGATGGATCCCTTGCCTTGAATTTGATGAGTTGGGGTGTGTTCGTAGAGAAAACAGCCATATGCCAGGGTACTATGACGGTAGGTATTGGACATTGTGGAAGCTACCAATGTTTGCTTGCAGTGACTCTTCGCAAGTGCTGAAGGAGATCCATGAATGCAGAAGGGTGTATCCAAATGCATATATACGTTGCTTAGCATTTGATAACCAGCGTCACATGCAGTCCATGGCTTTTATAGTTCACAAACCTGATATCACTACTACCACTTGA

Predicted protein sequences of Glyma13g00910

Limit To All Plant Sequences

>Glyma13g00910.1   sequence type=predicted peptide   gene model=Glyma13g00910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAATFAAHIAGAGFVGLKSNSSNLCPSTGSIGWKRKIVSNGSKTYCMKTWNPINNKKFETLSYLPPLSDESIAKEIDYMLKKGWIPCLEFDELGCVRRENSHMPGYYDGRYWTLWKLPMFACSDSSQVLKEIHECRRVYPNAYIRCLAFDNQRHMQSMAFIVHKPDITTTT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain