SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g00900

Feature Type:gene_model
Chromosome:Gm13
Start:621355
stop:624494
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g00900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57370AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1777 (InterPro:IPR013957); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:23244811-23245470 FORWARD LENGTH=219 SoyBaseE_val: 4.00E-41ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3263 KOG Nucleic acid binding protein JGI ISS
PF08648PFAM Protein of unknown function (DUF1777) JGI ISS
UniRef100_G7JVD2UniRef Annotation by Michelle Graham. Most informative UniRef hit: U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein n=1 Tax=Medicago truncatula RepID=G7JVD2_MEDTR SoyBaseE_val: 2.00E-58ISS
UniRef100_I1LVQ5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LVQ5_SOYBN SoyBaseE_val: 2.00E-123ISS

Expression Patterns of Glyma13g00900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g00900
ParalogEvidenceComments
Glyma17g06990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g00900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g097200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g00900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g00900
>Glyma13g00900.1   sequence type=CDS   gene model=Glyma13g00900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGGATCGTGACCGTGATCGAGACCGAGACCGAACTCGCGACAGAGAAAGAGAACGAAGAAGAGATAAGGACGACCGTGATCGCGACCGTGACCGAGCACGCAGCAAGAGATCTCGTTCGCGTTCGCCTGACCGTGGCCGCTCCCGCCACCTGCGCTCTCCCTCTCCCAGCGAACGCTCCCACCGCCGGCGGCACCACCGGACGCCGTCCCCTGACCCGCCGCGGAAGCGCCACCGGAGAGACTCGACGGAGGAGGAGCACAAGGAGACGAAGAAAGCGGTATCGGACTTCGTGGACGGCATCGTGAAGGAGCAGCAGCAGAAGCAGCAGAAGGATAACGGAGACGGAGGAGGAGAAGCTGAGGGGAACGAGGACGAGTTGGAGATGATGAAGATGTTTGGGATTCCCACCGGATTTGACTCCACCAAGGGGAAACCGGTTCCCGGTGCTGACGTCAGCGGCGTCAGAGCCGTCACCAAGCGCCAACCGCGCCAGTATATGAATCGCCGCGGCGGATTTAATCGCCCATTGCCTGCTGAGAAGAATCGCTAG
Predicted protein sequences of Glyma13g00900
>Glyma13g00900.1   sequence type=predicted peptide   gene model=Glyma13g00900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTDRDRDRDRDRTRDRERERRRDKDDRDRDRDRARSKRSRSRSPDRGRSRHLRSPSPSERSHRRRHHRTPSPDPPRKRHRRDSTEEEHKETKKAVSDFVDGIVKEQQQKQQKDNGDGGGEAEGNEDELEMMKMFGIPTGFDSTKGKPVPGADVSGVRAVTKRQPRQYMNRRGGFNRPLPAEKNR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo