SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g00640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g00640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g00640

Feature Type:gene_model
Chromosome:Gm13
Start:386316
stop:386754
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g00640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11320AT Annotation by Michelle Graham. TAIR10: Nucleotide-sugar transporter family protein | chr3:3547017-3548539 REVERSE LENGTH=308 SoyBaseE_val: 1.00E-55ISS
GO:0006863GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleobase transport SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008514GO-mf Annotation by Michelle Graham. GO Molecular Function: organic anion transmembrane transporter activity SoyBaseN/AISS
PTHR11132Panther SOLUTE CARRIER FAMILY 35 JGI ISS
UniRef100_D7L9W2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Organic anion transporter n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7L9W2_ARALL SoyBaseE_val: 6.00E-53ISS
UniRef100_I1M7Z0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M7Z0_SOYBN SoyBaseE_val: 3.00E-62ISS

Expression Patterns of Glyma13g00640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g00640 not represented in the dataset
Glyma13g00640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g00640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma13g00640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g00640
>Glyma13g00640.1   sequence type=CDS   gene model=Glyma13g00640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGTCCTCAAGTCATCTCTTCACGATTGGATTGGTGTCGGCGTGTATCCTATCTTCCTCCATGTGCCACATGATCACCTGCTCCCTTTTTAGCTATGTTGTCATCGCCTGGCTCAAGATGGTCCCCATGCAGACCATTCGCTCCTGCCTCCAGTTCCTCAAGATCGCCACCCTCAGCCTCGTCTTCTGCATTTTCATCGTTTTCGACAATGTCTCCCTCCGCTACCTTCCGGTGTCTTTCAACCAAGCCGTCGGCACCACCACCCCCTTCTTCACCGTCGTCTTCGCTTATATCATGACCTTCAAGCGTGAGGCCTGGCTCACCTATCTCACCCTCGTCCCCGTCGTCACCAGTGTCATCATTGCCAGCGGG
Predicted protein sequences of Glyma13g00640
>Glyma13g00640.1   sequence type=predicted peptide   gene model=Glyma13g00640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSSSHLFTIGLVSACILSSSMCHMITCSLFSYVVIAWLKMVPMQTIRSCLQFLKIATLSLVFCIFIVFDNVSLRYLPVSFNQAVGTTTPFFTVVFAYIMTFKREAWLTYLTLVPVVTSVIIASG






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo