SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma13g00530

Feature Type:gene_model
Chromosome:Gm13
Start:274047
stop:277241
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48175AT Annotation by Michelle Graham. TAIR10: Cytidine/deoxycytidylate deaminase family protein | chr1:17790957-17792066 FORWARD LENGTH=182 SoyBaseE_val: 9.00E-93ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
KOG1018 KOG Cytosine deaminase FCY1 and related enzymes JGI ISS
PTHR11079Panther CYTOSINE DEAMINASE JGI ISS
PF00383PFAM Cytidine and deoxycytidylate deaminase zinc-binding region JGI ISS
UniRef100_A2Q4B8UniRef Annotation by Michelle Graham. Most informative UniRef hit: CMP/dCMP deaminase, zinc-binding n=1 Tax=Medicago truncatula RepID=A2Q4B8_MEDTR SoyBaseE_val: 9.00E-105ISS
UniRef100_UPI0001890B88UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001890B88 related cluster n=1 Tax=unknown RepID=UPI0001890B88 SoyBaseE_val: 3.00E-132ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g06680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g100600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g00530.1   sequence type=CDS   gene model=Glyma13g00530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCTCATCCGAGACCCTTGCATTCATGGAGCTCGCCATACAACAGGCAAAGTTAGCTTTGGATGTTCTTGAAGTGCCCGTTGGATGTGTAATTGTTGAGGATGGCAAGGTTATAGCCTCAGGCAGGAATCGAACTACCGAGACACGAAATGCTACAAGGCATGCAGAAATGGAAGCTATAGATGTGCTTCTCGGGCAGTGGCAGAAACATGGACTTTCAATGTCCGAAGTTGCTGAAAAATTCTCAAACTGCAGCCTTTATGTTACCTGTGAACCATGCATAATGTGTGCATCTGCTTTATCAATTTTAGGTATAAAGGAAGTATTTTATGGCTGTTCAAATGATAAATTCGGAGGCTGTGGATCGATACTGTCATTGCATTTAAGTAACACTGCACCGCTCAATAATGAAGTTCCATCCGGAAAGTGTTTCAAATGTACTGGACGTATAATGGCATCAGAAGCTGTCCTTCTCTTTCGAACATTCTATGAGCAAGGAAATCCCAACGCTCCAAAGCCACACAGGCCTCTAGCACGTCAGGAATGA

>Glyma13g00530.1   sequence type=predicted peptide   gene model=Glyma13g00530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSSETLAFMELAIQQAKLALDVLEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLGQWQKHGLSMSEVAEKFSNCSLYVTCEPCIMCASALSILGIKEVFYGCSNDKFGGCGSILSLHLSNTAPLNNEVPSGKCFKCTGRIMASEAVLLFRTFYEQGNPNAPKPHRPLARQE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo