Report for Sequence Feature Glyma13g00530
Feature Type: gene_model
Chromosome: Gm13
Start: 274047
stop: 277241
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g00530
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G48175 AT
Annotation by Michelle Graham. TAIR10: Cytidine/deoxycytidylate deaminase family protein | chr1:17790957-17792066 FORWARD LENGTH=182
SoyBase E_val: 9.00E-93 ISS
GO:0009793 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003824 GO-mf
Annotation by Michelle Graham. GO Molecular Function: catalytic activity
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
GO:0016787 GO-mf
Annotation by Michelle Graham. GO Molecular Function: hydrolase activity
SoyBase N/A ISS
KOG1018
KOG
Cytosine deaminase FCY1 and related enzymes
JGI ISS
PTHR11079 Panther
CYTOSINE DEAMINASE
JGI ISS
PF00383 PFAM
Cytidine and deoxycytidylate deaminase zinc-binding region
JGI ISS
UniRef100_A2Q4B8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: CMP/dCMP deaminase, zinc-binding n=1 Tax=Medicago truncatula RepID=A2Q4B8_MEDTR
SoyBase E_val: 9.00E-105 ISS
UniRef100_UPI0001890B88 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0001890B88 related cluster n=1 Tax=unknown RepID=UPI0001890B88
SoyBase E_val: 3.00E-132 ISS
Expression Patterns of Glyma13g00530
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma13g00530
Paralog Evidence Comments
Glyma17g06680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g00530 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g100600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g00530
Coding sequences of Glyma13g00530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g00530.1 sequence type=CDS gene model=Glyma13g00530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACCTCATCCGAGACCCTTGCATTCATGGAGCTCGCCATACAACAGGCAAAGTTAGCTTTGGATGTTCTTGAAGTGCCCGTTGGATGTGTAATTGTTGAGGATGGCAAGGTTATAGCCTCAGGCAGGAATCGAACTACCGAGACACGAAATGCTACAAGGCATGCAGAAATGGAAGCTATAGATGTGCTTCTCGGGCAGTGGCAGAAACATGGACTTTCAATGTCCGAAGTTGCTGAAAAATTCTCAAACTGCAGCCTTTATGTTACCTGTGAACCATGCATAATGTGTGCATCTGCTTTATCAATTTTAGGTATAAAGGAAGTATTTTATGGCTGTTCAAATGATAAATTCGGAGGCTGTGGATCGATACTGTCATTGCATTTAAGTAACACTGCACCGCTCAATAATGAAGTTCCATCCGGAAAGTGTTTCAAATGTACTGGACGTATAATGGCATCAGAAGCTGTCCTTCTCTTTCGAACATTCTATGAGCAAGGAAATCCCAACGCTCCAAAGCCACACAGGCCTCTAGCACGTCAGGAATGA
Predicted protein sequences of Glyma13g00530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g00530.1 sequence type=predicted peptide gene model=Glyma13g00530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTSSETLAFMELAIQQAKLALDVLEVPVGCVIVEDGKVIASGRNRTTETRNATRHAEMEAIDVLLGQWQKHGLSMSEVAEKFSNCSLYVTCEPCIMCASALSILGIKEVFYGCSNDKFGGCGSILSLHLSNTAPLNNEVPSGKCFKCTGRIMASEAVLLFRTFYEQGNPNAPKPHRPLARQE*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
