SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g36760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g36760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g36760

Feature Type:gene_model
Chromosome:Gm12
Start:39813484
stop:39815885
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G47960AT Annotation by Michelle Graham. TAIR10: RAB GTPase homolog A4C | chr5:19421533-19422473 REVERSE LENGTH=223 SoyBaseE_val: 4.00E-96ISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0087 KOG GTPase Rab11/YPT3, small G protein superfamily JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF213Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_D7MKD0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Small molecular weight G-protein 1 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MKD0_ARALL SoyBaseE_val: 1.00E-94ISS
UniRef100_I1LVF0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LVF0_SOYBN SoyBaseE_val: 6.00E-170ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g36760 not represented in the dataset

Glyma12g36760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g00610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g238800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g36760.1   sequence type=CDS   gene model=Glyma12g36760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCAGTGGCAGGGTAATGCGGATGAGGGAATTGACTATATGTTCAAGATTGTGATGACTGGGGACTCTGGGGTGGGAAAGTCTCAGCTTTTGAATCGGTTTGTGAAAAACGAATTCCACATGAAATCGAAACCAACAATTGGGGTGGAGTTTCTGACTAGGACGGTCGTCATGGATCACAAACTTGTCAAAGCACAGATTTGGGACACTGCTGGTCAAGAAAGGTACCAGGCTATTACGACTGCGTATTACAGGGGTGCAACCGGCGCATTACTAGCATACGACATAACCAAGCAGCAAACCTTTGATCATGTTGAGAAGTGGTTGGATGAACTACGGATACACGCGGATAAAAACATACTTGTCATGCTTGTTGGCAACAAATCTGACCTGAGTTCTCTTCGAGCAGTGCCTACTGAGGTAGCCAGAGACTTTGCACAGCAGGAGGGTCTCTTCTTTCTCGAGACATCTGCGCTTGACTCCAGCAATGTGGAATCAGCTTTCATTGGTCTCCTCTCTCAAGTATATAGAACAGTCAGTAGGAAGCACATCCTTGTGGATGGACATGAATCAAATTGGGATAAAGTAAACCTTGAACTTGAAGGAACAAAAATTAAGGTCCCATCGCAAGAACCAGAATGCCAGAATGCTAAAAAGAGATTCAATTGTTGCAGTATTCTTTAG

>Glyma12g36760.1   sequence type=predicted peptide   gene model=Glyma12g36760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQWQGNADEGIDYMFKIVMTGDSGVGKSQLLNRFVKNEFHMKSKPTIGVEFLTRTVVMDHKLVKAQIWDTAGQERYQAITTAYYRGATGALLAYDITKQQTFDHVEKWLDELRIHADKNILVMLVGNKSDLSSLRAVPTEVARDFAQQEGLFFLETSALDSSNVESAFIGLLSQVYRTVSRKHILVDGHESNWDKVNLELEGTKIKVPSQEPECQNAKKRFNCCSIL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo