SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g36716

Feature Type:gene_model
Chromosome:Gm12
Start:39767573
stop:39768697
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g36716
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12630AT Annotation by Michelle Graham. TAIR10: A20/AN1-like zinc finger family protein | chr3:4012707-4013189 FORWARD LENGTH=160 SoyBaseE_val: 1.00E-38ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0051865GO-bp Annotation by Michelle Graham. GO Biological Process: protein autoubiquitination SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR10634Panther PRK1-ASSOCIATED ZINC FINGER PROTEIN JGI ISS
PF01428PFAM AN1-like Zinc finger JGI ISS
UniRef100_Q41123UniRef Annotation by Michelle Graham. Most informative UniRef hit: PVPR3 protein n=1 Tax=Phaseolus vulgaris RepID=Q41123_PHAVU SoyBaseE_val: 1.00E-71ISS
UniRef100_UPI0001CA9768UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001CA9768 related cluster n=1 Tax=unknown RepID=UPI0001CA9768 SoyBaseE_val: 1.00E-92ISS

Expression Patterns of Glyma12g36716
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g36716 not represented in the dataset
Glyma12g36716 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g36716
ParalogEvidenceComments
Glyma13g27410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g36716 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g238400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g36716
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g36716
>Glyma12g36716.1   sequence type=CDS   gene model=Glyma12g36716   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCAGAAGGCCGAGAAAAACGACACCGACTTTAAGGTCCCCGAAACCATCATCACCCCCTGCACCACCACCACCGCCACCTCGATTACCGAACCTTCTAGATTCTTCGACGCAACCACCCCCGCCACGTCATCGCGCTCCCCCAAGCGATCCCTCCCCCTCGACGACGAATCTCAGACGGACCAAACGGCGTCGTCGGAGCCCAAACGCGTCGTGAGCCGCTGCTCCTGCTGTCGGCGGCGCGTGGGGCTCACTGGATTCCGGTGCCGCTGTGGCGACCTCTTCTGCGCCGAGCACCGCTACTCCGACCGCCACGACTGCTCCTACGACTACAAGGCCGCAGGGAGAGAGGCCATAGCGAGAGAAAACCCCGTCGTGAAGGCCGCGAAGATCGTCAAGGTCTGA
Predicted protein sequences of Glyma12g36716
>Glyma12g36716.1   sequence type=predicted peptide   gene model=Glyma12g36716   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQKAEKNDTDFKVPETIITPCTTTTATSITEPSRFFDATTPATSSRSPKRSLPLDDESQTDQTASSEPKRVVSRCSCCRRRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENPVVKAAKIVKV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo