|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00550 | AT | Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein J | chrC:63538-63660 REVERSE LENGTH=40 | SoyBase | E_val: 2.00E-18 | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0009523 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem II | SoyBase | N/A | ISS |
| GO:0009539 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem II reaction center | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| PF01788 | PFAM | PsbJ | JGI | ISS | |
| UniRef100_Q9BBR7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Photosystem II reaction center protein J n=6 Tax=Papilionoideae RepID=PSBJ_LOTJA | SoyBase | E_val: 2.00E-17 | ISS |
| UniRef100_Q9BBR7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center protein J n=6 Tax=Papilionoideae RepID=PSBJ_LOTJA | SoyBase | E_val: 2.00E-17 | ISS |
|
Glyma12g36141 not represented in the dataset |
Glyma12g36141 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g232800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g36141.1 sequence type=CDS gene model=Glyma12g36141 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCGATACTACTGGAAGGATTCCTCTTTGGATAATAGGTACTGTAACTGGTATTACTGTGATCGGTTTAATTGGTATTTTCTTTTATGGTTCATATTCCGGATTGGGCTCATCTCTGTAG
>Glyma12g36141.1 sequence type=predicted peptide gene model=Glyma12g36141 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MADTTGRIPLWIIGTVTGITVIGLIGIFFYGSYSGLGSSL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||