SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g36141): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g36141): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g36141

Feature Type:gene_model
Chromosome:Gm12
Start:39217429
stop:39217551
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g36141
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00550AT Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein J | chrC:63538-63660 REVERSE LENGTH=40 SoyBaseE_val: 2.00E-18ISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009539GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II reaction center SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PF01788PFAM PsbJ JGI ISS
UniRef100_Q9BBR7UniRef Annotation by Michelle Graham. Best UniRef hit: Photosystem II reaction center protein J n=6 Tax=Papilionoideae RepID=PSBJ_LOTJA SoyBaseE_val: 2.00E-17ISS
UniRef100_Q9BBR7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center protein J n=6 Tax=Papilionoideae RepID=PSBJ_LOTJA SoyBaseE_val: 2.00E-17ISS

Expression Patterns of Glyma12g36141
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g36141 not represented in the dataset
Glyma12g36141 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g36141 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g232800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g36141
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g36141
>Glyma12g36141.1   sequence type=CDS   gene model=Glyma12g36141   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGATACTACTGGAAGGATTCCTCTTTGGATAATAGGTACTGTAACTGGTATTACTGTGATCGGTTTAATTGGTATTTTCTTTTATGGTTCATATTCCGGATTGGGCTCATCTCTGTAG
Predicted protein sequences of Glyma12g36141
>Glyma12g36141.1   sequence type=predicted peptide   gene model=Glyma12g36141   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADTTGRIPLWIIGTVTGITVIGLIGIFFYGSYSGLGSSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo