Glyma12g36132 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g36132): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g36132): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g36132

Feature Type:	gene_model
Chromosome:	Gm12
Start:	39216769
stop:	39217288
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g36132

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00580	AT	Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein E \| chrC:64071-64322 REVERSE LENGTH=83	SoyBase	E_val: 2.00E-52	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0009767	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain	SoyBase	N/A	ISS
GO:0009769	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting in photosystem II	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009523	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem II	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009539	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: photosystem II reaction center	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009654	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
PF00283	PFAM	Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits	JGI		ISS
PF00284	PFAM	Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit	JGI		ISS
PF02419	PFAM	PsbL protein	JGI		ISS
UniRef100_D7KRH8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Cytochrome b559 subunit alpha n=3 Tax=core eudicotyledons RepID=D7KRH8_ARALL	SoyBase	E_val: 8.00E-88	ISS
UniRef100_D7KRH8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b559 subunit alpha n=3 Tax=core eudicotyledons RepID=D7KRH8_ARALL	SoyBase	E_val: 8.00E-88	ISS

Expression Patterns of Glyma12g36132

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g36132 not represented in the dataset	Glyma12g36132 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g36132 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g232700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g36132

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g36132

Limit To All Plant Sequences

>Glyma12g36132.1   sequence type=CDS   gene model=Glyma12g36132   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGAAGCACAGGAGAACGTTCTTTTGCTGATATTATTACCAGTATCCGATACTGGATTATTCATAGCATTACTATACCCTCCCTATTCATTGCAGGTTGGTTATTTGTCAGCACGGGTCTAGCTTACGATGTTTTTGGAAGCCCCCGCCCAAACGAATATTTTACAGAGAGCCGACAAGGAATTCCATTAATAACTGGCCGTTTTGATCCTTTGGAACAACTTGATGAATTTATACGATGGTTGGCTGTTCACGGACTAGCGGTACCCACTGTTTCTTTTTTGGGATCAATATCAGCAATGCAAGCTACGACACAATCAAACCCAAATGAACAAAATGTTGAATTGAATCGTACCAGTCTCTACTGGGGGTTATTACTCATTTTTGTACTTGCTGTTTTATTTTCAAATTATTTCTTCAATTAA

Predicted protein sequences of Glyma12g36132

Limit To All Plant Sequences

>Glyma12g36132.1   sequence type=predicted peptide   gene model=Glyma12g36132   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGSTGERSFADIITSIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDPLEQLDEFIRWLAVHGLAVPTVSFLGSISAMQATTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain