|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00600 | AT | Annotation by Michelle Graham. TAIR10: PETG | chrC:65998-66111 FORWARD LENGTH=37 | SoyBase | E_val: 2.00E-18 | ISS |
| GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
| GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
| GO:0009767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain | SoyBase | N/A | ISS |
| GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009512 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytochrome b6f complex | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF02529 | PFAM | Cytochrome B6-F complex subunit 5 | JGI | ISS | |
| UniRef100_Q3V516 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Cytochrome b6-f complex subunit 5 n=251 Tax=Magnoliophyta RepID=PETG_ACOCL | SoyBase | E_val: 3.00E-16 | ISS |
| UniRef100_Q3V516 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b6-f complex subunit 5 n=251 Tax=Magnoliophyta RepID=PETG_ACOCL | SoyBase | E_val: 3.00E-16 | ISS |
|
Glyma12g36123 not represented in the dataset |
Glyma12g36123 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g232500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g36123.1 sequence type=CDS gene model=Glyma12g36123 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATTGAAGTTTTTCTATTTGGAATCGTGTTAGGTTTAATTCCCATTACTTTGGCTGGATTATTTGTAACTGCATATTTACAATACCGACGAGGTGATCAGTTGGATCTTTGA
>Glyma12g36123.1 sequence type=predicted peptide gene model=Glyma12g36123 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||