SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g35411): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g35411): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g35411

Feature Type:gene_model
Chromosome:Gm12
Start:38536531
stop:38537951
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g35411
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53870AT Annotation by Michelle Graham. TAIR10: early nodulin-like protein 1 | chr5:21870033-21871228 REVERSE LENGTH=370 SoyBaseE_val: 2.00E-47ISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF02298PFAM Plastocyanin-like domain JGI ISS
UniRef100_B9SQI2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Copper ion binding protein, putative n=1 Tax=Ricinus communis RepID=B9SQI2_RICCO SoyBaseE_val: 6.00E-52ISS
UniRef100_UPI000233BA97UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BA97 related cluster n=1 Tax=unknown RepID=UPI000233BA97 SoyBaseE_val: 2.00E-87ISS

Expression Patterns of Glyma12g35411
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g35411 not represented in the dataset
Glyma12g35411 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g35411
ParalogEvidenceComments
Glyma13g35100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g35411 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma12g35411
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g35411
>Glyma12g35411.1   sequence type=CDS   gene model=Glyma12g35411   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACTTGAGATACGTGCTTGTCTCTTGTTGTTTCTCTTTAGTCTCTTCTCATGCTCTCAAGCCTACACTTTCTATGTTGGTGGGAAAGATGGGTGGGTTTTGTACCCTTCTGAGAATTACAATCATTGGGCTGAAAGGATGAGGTTCCAAGTCAGTGATACTCTTGTTTTTAAGTACAAGAAGGGCTCGGATACTGTGTTGGTGGTGAACAAGGATGATTATGAGAAATGTAACAAGAAGAACCCGATCAAGAAGTTTGAGGATAGTGAATCGGAGTTTCAGTTTGATCGATCGGGTCCATTTTACTTCATTAGTGGGAAAGATGGTAATTGTGAAAAGGGTCAGAAATTGATTATTGTGGTGTTGGCTGTGAGAGAGCCACCTCCTTATTATCCTCCAACACCTCCAAACACTCCCTATGTTCCAATTACTCCTCCAAAAGCACCTTATGTTCCAACACCTCCCTCAAACTCCTCCAAAAATTCCTTATCCACCTTATGTTCCAACCCCTCCAAAAACACCTTCTCCTATTCACAGTCCTCCCTATGTTCCTCCTAA
Predicted protein sequences of Glyma12g35411
>Glyma12g35411.1   sequence type=predicted peptide   gene model=Glyma12g35411   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELEIRACLLLFLFSLFSCSQAYTFYVGGKDGWVLYPSENYNHWAERMRFQVSDTLVFKYKKGSDTVLVVNKDDYEKCNKKNPIKKFEDSESEFQFDRSGPFYFISGKDGNCEKGQKLIIVVLAVREPPPYYPPTPPNTPYVPITPPKAPYVPTPPSNSSKNSLSTLCSNPSKNTFSYSQSSLCSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo