SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g34320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g34320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g34320

Feature Type:gene_model
Chromosome:Gm12
Start:37478078
stop:37479891
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01440AT Annotation by Michelle Graham. TAIR10: PsbQ-like 1 | chr3:168478-169407 FORWARD LENGTH=220 SoyBaseE_val: 2.00E-73ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0009767GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0009344GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nitrite reductase complex [NAD(P)H] SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex SoyBaseN/AISS
GO:0019898GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to membrane SoyBaseN/AISS
GO:0030095GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast photosystem II SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0045156GO-mf Annotation by Michelle Graham. GO Molecular Function: electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity SoyBaseN/AISS
PF05757PFAM Oxygen evolving enhancer protein 3 (PsbQ) JGI ISS
UniRef100_G7IHD6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Oxygen-evolving enhancer protein 3-1 n=1 Tax=Medicago truncatula RepID=G7IHD6_MEDTR SoyBaseE_val: 6.00E-122ISS
UniRef100_I1LUR9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LUR9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g34320 not represented in the dataset

Glyma12g34320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g36240 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g215100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g34320.1   sequence type=CDS   gene model=Glyma12g34320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCATCTTTCATTCTCAGACCTCACACATATGAGTTCCTTCACCACCATCATGGCTCCTGTGACAAACTTGCATGGAGCAGTCTCCAAAACCTTAATTCCCATCACATGCCACCTTCCAAATGCACACAAAAGCATAACAAAGAGAGGACAAGTGATTGGATTTCTTGGAAGCAAAGCACAAAAGGAAGCATCAGAGTGTCAAGTTCAGGCCACAAGAAGAGCAGCAGCATTAGGCCTTGCCACTGTAGTGCTTACTTGGCAATTCAATGACAAGGTTTCATTGGCTAAAGATAATGGTTTCTGGTATGAGGATCATCCTCTCCCTGGACCAACTGTCACTAACAATATTGCAAATGAGAAAACGGGAACACGTTCTTTTCTTAAGAGGGGGCTTTACATAGCAAACATTGGAGTGAAAGGAAGTGTGTTTAGGATAAAGAAATATGCCTTTGATCTTCTGGCAATGGCGGATTTGATAGCAGAAGACACACTCAACTATGTGAGGAAGTACCTAAGACTCAAGTCCACATTCATGTACTATGATTTTGACAAGGTTATCTCTGCCATTCCAGTGGATGATAAGCAGCAACTAACTGATATGGCTAACAAATTGTTTGATAATTTTGAAAGGCTTGAAGAAGCTTCAAGGAAGAAAAGTCTACCTGAAACAAAATCATGCTATCAGGAAACTGAAGTTATGCTTAAAGAGGTCATGGACAAGATGGATATAATGTACAAATCAATTTGA

>Glyma12g34320.1   sequence type=predicted peptide   gene model=Glyma12g34320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNHLSFSDLTHMSSFTTIMAPVTNLHGAVSKTLIPITCHLPNAHKSITKRGQVIGFLGSKAQKEASECQVQATRRAAALGLATVVLTWQFNDKVSLAKDNGFWYEDHPLPGPTVTNNIANEKTGTRSFLKRGLYIANIGVKGSVFRIKKYAFDLLAMADLIAEDTLNYVRKYLRLKSTFMYYDFDKVISAIPVDDKQQLTDMANKLFDNFERLEEASRKKSLPETKSCYQETEVMLKEVMDKMDIMYKSI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo