SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g34210

Feature Type:gene_model
Chromosome:Gm12
Start:37392243
stop:37393505
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g34210
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20600AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family | chr3:7194877-7195536 FORWARD LENGTH=219 SoyBaseE_val: 3.00E-43ISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009626GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0010942GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell death SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_D8WJ57UniRef Annotation by Michelle Graham. Best UniRef hit: NDR1b protein n=1 Tax=Glycine max RepID=D8WJ57_SOYBN SoyBaseE_val: 2.00E-158ISS
UniRef100_D8WJ57UniRef Annotation by Michelle Graham. Most informative UniRef hit: NDR1b protein n=1 Tax=Glycine max RepID=D8WJ57_SOYBN SoyBaseE_val: 2.00E-158ISS

Expression Patterns of Glyma12g34210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g34210
ParalogEvidenceComments
Glyma13g36340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g34210 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g214100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g34210
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g34210
>Glyma12g34210.1   sequence type=CDS   gene model=Glyma12g34210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCGGAGCACGACAGCTGCTGCTCGCGCTGTGTCACCTTCCTAATAACCATAGGCCTCACAGCGCTCTTCCTATGGCTGAGTCTCCGCGTTGACGAACCAAAATGCTACCTCGACTACATTTACGTTCCTGCCCTCAACAAAACCCTAAATTCCAATTCCACTCACAACAAAAACACCACAATACTCTTCGCTCTCAAGCTCACCAACGGGAACAAGGACAAAGGCATCCAATACGACGACGTTCTCCTCTCCTTCAGAGTCTTCGAGAGCGTCAACCTCACGCGCCCACTCGGCAACGCCACCGTGCAAAGGTTCTACCAGGGCCACCAGAAGAAGGCCACCAAGCACGGAAACTTCAGCGGCGGCGGCGGAAACCTCACCGCGGCGGTGGCTGGGAGAATGTGGTACCGTGTGGACTATGCTACTGCGGTGAAGTACAAGATTCTCTTCTGGTACACGAAACGGCACCGTTTATGGGGAGGGGCAAATGTGGAAATTGGCGATTCGGGAATGAAGGTGTATCGTAAAGCCGTTAGGCTTGGAGGGAAGAACCCCGTGGTGATCGAGTCCGGCGCATCTAAGCTCAGTGGACGCTATCGTGCGCTTCTTCTTTCCCTTCTTCTCCCTTTTTGTGGCTTGTGGGTTTAG
Predicted protein sequences of Glyma12g34210
>Glyma12g34210.1   sequence type=predicted peptide   gene model=Glyma12g34210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAEHDSCCSRCVTFLITIGLTALFLWLSLRVDEPKCYLDYIYVPALNKTLNSNSTHNKNTTILFALKLTNGNKDKGIQYDDVLLSFRVFESVNLTRPLGNATVQRFYQGHQKKATKHGNFSGGGGNLTAAVAGRMWYRVDYATAVKYKILFWYTKRHRLWGGANVEIGDSGMKVYRKAVRLGGKNPVVIESGASKLSGRYRALLLSLLLPFCGLWV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo