Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g32580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g32580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma12g32580
Feature Type: gene_model
Chromosome: Gm12
Start: 36088307
stop: 36091672
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma12g32580
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G03280 AT
Annotation by Michelle Graham. TAIR10: photosynthetic electron transfer C | chr4:1440314-1441717 FORWARD LENGTH=229
SoyBase E_val: 2.00E-107 ISS
GO:0000165 GO-bp
Annotation by Michelle Graham. GO Biological Process: MAPK cascade
SoyBase N/A ISS
GO:0006098 GO-bp
Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt
SoyBase N/A ISS
GO:0006364 GO-bp
Annotation by Michelle Graham. GO Biological Process: rRNA processing
SoyBase N/A ISS
GO:0006612 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane
SoyBase N/A ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0009595 GO-bp
Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus
SoyBase N/A ISS
GO:0009657 GO-bp
Annotation by Michelle Graham. GO Biological Process: plastid organization
SoyBase N/A ISS
GO:0009697 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process
SoyBase N/A ISS
GO:0009767 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain
SoyBase N/A ISS
GO:0009814 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction
SoyBase N/A ISS
GO:0009862 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0010196 GO-bp
Annotation by Michelle Graham. GO Biological Process: nonphotochemical quenching
SoyBase N/A ISS
GO:0010200 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to chitin
SoyBase N/A ISS
GO:0010207 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosystem II assembly
SoyBase N/A ISS
GO:0010310 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process
SoyBase N/A ISS
GO:0010363 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response
SoyBase N/A ISS
GO:0019684 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction
SoyBase N/A ISS
GO:0031348 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0043900 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process
SoyBase N/A ISS
GO:0050832 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to fungus
SoyBase N/A ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:0080167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to karrikin
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009512 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytochrome b6f complex
SoyBase N/A ISS
GO:0009534 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid
SoyBase N/A ISS
GO:0009535 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane
SoyBase N/A ISS
GO:0009579 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0008121 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ubiquinol-cytochrome-c reductase activity
SoyBase N/A ISS
GO:0009496 GO-mf
Annotation by Michelle Graham. GO Molecular Function: plastoquinol--plastocyanin reductase activity
SoyBase N/A ISS
GO:0016491 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity
SoyBase N/A ISS
GO:0016679 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on diphenols and related substances as donors
SoyBase N/A ISS
GO:0046028 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron transporter, transferring electrons from cytochrome b6/f complex of photosystem II activity
SoyBase N/A ISS
GO:0051537 GO-mf
Annotation by Michelle Graham. GO Molecular Function: 2 iron, 2 sulfur cluster binding
SoyBase N/A ISS
KOG1671
KOG
Ubiquinol cytochrome c reductase, subunit RIP1
JGI ISS
PTHR10134 Panther
UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT-RELATED
JGI ISS
PF00355 PFAM
Rieske [2Fe-2S] domain
JGI ISS
PF08802 PFAM
Cytochrome B6-F complex Fe-S subunit
JGI ISS
UniRef100_I1LUB3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b6-f complex iron-sulfur subunit n=1 Tax=Glycine max RepID=I1LUB3_SOYBN
SoyBase E_val: 2.00E-166 ISS
UniRef100_I1LUB3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Cytochrome b6-f complex iron-sulfur subunit n=1 Tax=Glycine max RepID=I1LUB3_SOYBN
SoyBase E_val: 2.00E-166 ISS
Expression Patterns of Glyma12g32580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma12g32580
Paralog Evidence Comments
Glyma13g37880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma12g32580 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.12g199400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma12g32580
Coding sequences of Glyma12g32580
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma12g32580.1 sequence type=CDS gene model=Glyma12g32580 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCATCCACCACTCTATCCCCTACAACCCCTTCTCAGCTATGCTCAGGAAAGAGTGGGATTTTCAGTCCCTCACAGGCACTTCTTGTGAAGCCAGTGAAGAGGCAGATGATGGGGAAGAGCAAGGGAATGAGAATTGCATGCCAAGCCACCAGCATTCCTGCTGATAGAGTCCCTGACATGGGCAAAAGACAGCTCATGAATCTGCTTCTTCTTGGTGCCATTTCACTCCCCTCTGCTGGAATGCTTATTCCCTACACCTACTTTTTTGTCCCTCCAGGTTCAGGTTCTTCAGCTGGTGGTACTGTTGCCAAGGATGCTGTTGGAAATGATGTAATTGCAGAGAATTGGCTCAAGGCACATGGACCTGGTGACCGAACCCTTGCACAAGGATTGAAGGGAGATCCTACCTATCTTGTTGTGGAGAAAGACAGAACCCTTGCAACATATGCAATTAATGCCGTGTGCACTCACCTTGGATGTGTCGTGCCATGGAATCAAGCAGAGAACAAGTTCATCTGCCCTTGCCATGGATCTCAGTACAATGACCAAGGAAGAGTTGTGAGAGGACCTGCTCCCTTGTCTCTGGCATTAGCACATTGTGATATAGATGATGGGAAGGTGGTGTTTGTTCCTTGGGTTGAAACAGATTTCAGAACAGGTGATGCTCCATGGTGGGCTTAG
Predicted protein sequences of Glyma12g32580
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma12g32580.1 sequence type=predicted peptide gene model=Glyma12g32580 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASTTLSPTTPSQLCSGKSGIFSPSQALLVKPVKRQMMGKSKGMRIACQATSIPADRVPDMGKRQLMNLLLLGAISLPSAGMLIPYTYFFVPPGSGSSAGGTVAKDAVGNDVIAENWLKAHGPGDRTLAQGLKGDPTYLVVEKDRTLATYAINAVCTHLGCVVPWNQAENKFICPCHGSQYNDQGRVVRGPAPLSLALAHCDIDDGKVVFVPWVETDFRTGDAPWWA*