SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g32580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g32580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g32580

Feature Type:gene_model
Chromosome:Gm12
Start:36088307
stop:36091672
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G03280AT Annotation by Michelle Graham. TAIR10: photosynthetic electron transfer C | chr4:1440314-1441717 FORWARD LENGTH=229 SoyBaseE_val: 2.00E-107ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009767GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010196GO-bp Annotation by Michelle Graham. GO Biological Process: nonphotochemical quenching SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009512GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytochrome b6f complex SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008121GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquinol-cytochrome-c reductase activity SoyBaseN/AISS
GO:0009496GO-mf Annotation by Michelle Graham. GO Molecular Function: plastoquinol--plastocyanin reductase activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016679GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on diphenols and related substances as donors SoyBaseN/AISS
GO:0046028GO-mf Annotation by Michelle Graham. GO Molecular Function: electron transporter, transferring electrons from cytochrome b6/f complex of photosystem II activity SoyBaseN/AISS
GO:0051537GO-mf Annotation by Michelle Graham. GO Molecular Function: 2 iron, 2 sulfur cluster binding SoyBaseN/AISS
KOG1671 KOG Ubiquinol cytochrome c reductase, subunit RIP1 JGI ISS
PTHR10134Panther UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT-RELATED JGI ISS
PF00355PFAM Rieske [2Fe-2S] domain JGI ISS
PF08802PFAM Cytochrome B6-F complex Fe-S subunit JGI ISS
UniRef100_I1LUB3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b6-f complex iron-sulfur subunit n=1 Tax=Glycine max RepID=I1LUB3_SOYBN SoyBaseE_val: 2.00E-166ISS
UniRef100_I1LUB3UniRef Annotation by Michelle Graham. Best UniRef hit: Cytochrome b6-f complex iron-sulfur subunit n=1 Tax=Glycine max RepID=I1LUB3_SOYBN SoyBaseE_val: 2.00E-166ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g32580 not represented in the dataset

Glyma12g32580 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g37880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g199400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g32580.1   sequence type=CDS   gene model=Glyma12g32580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCCACCACTCTATCCCCTACAACCCCTTCTCAGCTATGCTCAGGAAAGAGTGGGATTTTCAGTCCCTCACAGGCACTTCTTGTGAAGCCAGTGAAGAGGCAGATGATGGGGAAGAGCAAGGGAATGAGAATTGCATGCCAAGCCACCAGCATTCCTGCTGATAGAGTCCCTGACATGGGCAAAAGACAGCTCATGAATCTGCTTCTTCTTGGTGCCATTTCACTCCCCTCTGCTGGAATGCTTATTCCCTACACCTACTTTTTTGTCCCTCCAGGTTCAGGTTCTTCAGCTGGTGGTACTGTTGCCAAGGATGCTGTTGGAAATGATGTAATTGCAGAGAATTGGCTCAAGGCACATGGACCTGGTGACCGAACCCTTGCACAAGGATTGAAGGGAGATCCTACCTATCTTGTTGTGGAGAAAGACAGAACCCTTGCAACATATGCAATTAATGCCGTGTGCACTCACCTTGGATGTGTCGTGCCATGGAATCAAGCAGAGAACAAGTTCATCTGCCCTTGCCATGGATCTCAGTACAATGACCAAGGAAGAGTTGTGAGAGGACCTGCTCCCTTGTCTCTGGCATTAGCACATTGTGATATAGATGATGGGAAGGTGGTGTTTGTTCCTTGGGTTGAAACAGATTTCAGAACAGGTGATGCTCCATGGTGGGCTTAG

>Glyma12g32580.1   sequence type=predicted peptide   gene model=Glyma12g32580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTTLSPTTPSQLCSGKSGIFSPSQALLVKPVKRQMMGKSKGMRIACQATSIPADRVPDMGKRQLMNLLLLGAISLPSAGMLIPYTYFFVPPGSGSSAGGTVAKDAVGNDVIAENWLKAHGPGDRTLAQGLKGDPTYLVVEKDRTLATYAINAVCTHLGCVVPWNQAENKFICPCHGSQYNDQGRVVRGPAPLSLALAHCDIDDGKVVFVPWVETDFRTGDAPWWA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo