|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G22060 | AT | Annotation by Michelle Graham. TAIR10: Receptor-like protein kinase-related family protein | chr3:7771065-7772137 FORWARD LENGTH=252 | SoyBase | E_val: 1.00E-46 | ISS |
GO:0002237 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin | SoyBase | N/A | ISS |
GO:0009737 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
PTHR11795 | Panther | PROTEIN KINASE | JGI | ISS | |
PF01657 | PFAM | Domain of unknown function DUF26 | JGI | ISS | |
UniRef100_G7IKM1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cysteine-rich repeat secretory protein n=1 Tax=Medicago truncatula RepID=G7IKM1_MEDTR | SoyBase | E_val: 3.00E-59 | ISS |
UniRef100_I1LU84 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LU84_SOYBN | SoyBase | E_val: 9.00E-83 | ISS |
Glyma12g32241 not represented in the dataset |
Glyma12g32241 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.12g196300 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g32241.1 sequence type=CDS gene model=Glyma12g32241 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTCAGGTACTTGGACACTGATTTCCTTGGCAAAATTGACAACACAAACAAGTTCTACATGTGGAACTTGAAAAATGTGAGTGACCCTGCAACGTTTAATTATAAGACTAGAGAGTTGTTGAGCCAGCTTGCTCAGAAAACTTATGTGATGAATAATAAATTGTATGCAACTGGAGAGGTAAAGCTTGAGAATTCAGAGACACTTTATGGGTTGACTCAGTGCACTAGAGATCTTTCTAGCAGTGATTGCAAGAAGTGTCTTGATGATGCAATCAATGAACTCCCAAATTGTTGTGATGACAAAGAAGGAGGTAGAGTTGTGAGTGGAAGCTGCAACTTCCGTTATGAGATATACTTCTTTGTTAAGGAGTAA
>Glyma12g32241.1 sequence type=predicted peptide gene model=Glyma12g32241 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFRYLDTDFLGKIDNTNKFYMWNLKNVSDPATFNYKTRELLSQLAQKTYVMNNKLYATGEVKLENSETLYGLTQCTRDLSSSDCKKCLDDAINELPNCCDDKEGGRVVSGSCNFRYEIYFFVKE*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||