Glyma12g32080 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g32080

Feature Type:	gene_model
Chromosome:	Gm12
Start:	35679266
stop:	35679826
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g32080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G05975	AT	Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family \| chr3:1792145-1792714 REVERSE LENGTH=189	SoyBase	E_val: 2.00E-18	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03168	PFAM	Late embryogenesis abundant protein	JGI		ISS
UniRef100_I1LU67	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1LU67_SOYBN	SoyBase	E_val: 7.00E-131	ISS
UniRef100_Q1STP6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Harpin-induced 1 n=2 Tax=Medicago truncatula RepID=Q1STP6_MEDTR	SoyBase	E_val: 5.00E-30	ISS

Expression Patterns of Glyma12g32080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g32080

Paralog	Evidence	Comments
Glyma13g38400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g32080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g194700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g32080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g32080

Limit To All Plant Sequences

>Glyma12g32080.2   sequence type=CDS   gene model=Glyma12g32080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAATAGAGGCCTCAAAATTTGCTTGGCTGTGTCTCTACTCTTCTTGGTCATCGTTACAATTATGATTGTGACTTTATTTATGACCATCTTTAAGCCCAAAAATCCTGAAATCACTGTCCACCCTGTTGGTCTAGAAGACTTTCAATTTTCCCTTTCACCCAATTTGACCATAAATGTGACTCTAGGCATGATAATTACTATAAGGAATCCAAACTATGGAAGCTTCGAGTACAAAAACTCCACTGGTTATGTGAATTTTCATGATACCGTGGTAGCCGAAGTTCCAATAGAAGCAGAGTTAGTTCCAGCACGTGGCCAGATTAATGTGAACACTTCAGCAGATTTTATGGTAGAAAAGTTAATCAATGATCCTAATTTTTTGTCAGATGTTCTAGGTGGAACTTTGAATTTCACATCAACAACTGCACTTCCTGGGAAAGCCCGTATGTTCAACATTATCAAATTGAAGGCCACGTCTTATAGCTCATGTGACATCTCTGTTAATATAAGCTCTAGGAAAGTTGATACCAATTGCAATTACAAAATCAAGCTTTAA

Predicted protein sequences of Glyma12g32080

Limit To All Plant Sequences

>Glyma12g32080.2   sequence type=predicted peptide   gene model=Glyma12g32080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANRGLKICLAVSLLFLVIVTIMIVTLFMTIFKPKNPEITVHPVGLEDFQFSLSPNLTINVTLGMIITIRNPNYGSFEYKNSTGYVNFHDTVVAEVPIEAELVPARGQINVNTSADFMVEKLINDPNFLSDVLGGTLNFTSTTALPGKARMFNIIKLKATSYSSCDISVNISSRKVDTNCNYKIKL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain