|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G11780 | AT | Annotation by Michelle Graham. TAIR10: MD-2-related lipid recognition domain-containing protein / ML domain-containing protein | chr3:3724326-3725476 REVERSE LENGTH=153 | SoyBase | E_val: 2.00E-28 | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0010167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nitrate | SoyBase | N/A | ISS |
GO:0015706 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrate transport | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
PF02221 | PFAM | ML domain | JGI | ISS | |
UniRef100_F4YFC2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Phosphatidylglycerol/phosphatidylinositol transfer protein n=1 Tax=Camellia sinensis RepID=F4YFC2_CAMSI | SoyBase | E_val: 4.00E-29 | ISS |
UniRef100_UPI000233C719 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C719 related cluster n=1 Tax=unknown RepID=UPI000233C719 | SoyBase | E_val: 2.00E-86 | ISS |
Glyma12g31643 not represented in the dataset |
Glyma12g31643 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.12g190300 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g31643.1 sequence type=CDS gene model=Glyma12g31643 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGGCAACGAGAGTGAACACAACAGGATGGGATGGAGGCAAAGTTATTGTCTATCACAAGCGGAGGCAACGACGACAGGATGGGATTCTCGACGGCATTAGGGTGATGTCATGCACGAGTTTATCTGATGTAAACTATGCTGTGAAGGTGTCTGGAATTGAAATTACACCAGACCCTGTTGTGCGTGCTAGGCCTGCCACCTTTAAGATTTCAGCTGCTACTGGTGAAGCTATTTATGGAGGAAAGTGGGTAACTGCAGTTGCATACTTCGGTTTTGTTGTCCTCAAAGAAATCCATGATTTTTGTGAGGAAATATCATGTCCTGTTGCTACTGGCAGTTTTGTGGCTGCTCACACCCAAAAATTGCCTGCATTTGCCCCACCAGTTAGTTTCAATTTACCATATATAATCTTTTAG
>Glyma12g31643.1 sequence type=predicted peptide gene model=Glyma12g31643 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEATRVNTTGWDGGKVIVYHKRRQRRQDGILDGIRVMSCTSLSDVNYAVKVSGIEITPDPVVRARPATFKISAATGEAIYGGKWVTAVAYFGFVVLKEIHDFCEEISCPVATGSFVAAHTQKLPAFAPPVSFNLPYIIF*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||